SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_01119T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_01119T0
Domain Number 1 Region: 152-222
Classification Level Classification E-value
Superfamily PKD domain 0.000000000196
Family PKD domain 0.0046
Further Details:      
 
Domain Number 2 Region: 278-472
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000074
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  CAOG_01119T0
Domain Number - Region: 46-87
Classification Level Classification E-value
Superfamily PKD domain 0.00157
Family PKD domain 0.012
Further Details:      
 
Domain Number - Region: 237-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0102
Family EGF-type module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAOG_01119T0
Sequence length 840
Comment | CAOG_01119 | Capsaspora owczarzaki ATCC 30864 hypothetical protein (841 aa)
Sequence
MIRNSWIVCLSVALLALSAAQLVAGLVSVATISGPVNVNEGDSNTWTVSVTNVPANMLLT
YSWTFGDGTHTGIINNTKVDKVYAVPNSVAAGTDASYTIRVFIENTLKGGSNPTFQVSTE
MKVRVLNTNPVISNILSYVRDGSTLVPYNGQVAVGTNFQFQAEAYDVSGTNLQYSWLFGD
CTKGAAGKSEVYHQFHFPGVFTITLQVTDPYGGYSISSTQVTIDCSPQITNGTDDFLNNG
NCHLYGKCTKISAGNFTCLCETGFMGDGFTCQRTFNPCLPGYAGYRDCVVNQGNLECIPE
TLSAGMYTGGYQCSTCRPGFYRASGECRKIDNPCASFESEASVTCRQADGGRGLTCIPEI
ITIGDGVHEALFTGKASCGDTCPPGFVAITDAGNSQLYCQVVINPCSTGNYGADNCTGLG
YTTCVPAVTPDSAGSLFPLYTGAYTCGNDAQCQPGYTLTPNRLACVLIPNPCRVPSAGYS
ACAAQNRECFPAFTLDGSGNTLYLGDNKYSCGGCGTGYIETTIYDPVLQRNRQACAKRPN
PCDSGQAGSLDCSTTRLCLPVAVPNTNLYSGQYVCVTPDTLSCPEGYETSRDESTNHLVC
VPTAASNSAATSRNIGIAVGLALLALIVVIILFVIWRRKRSTQAKISYNYAQKQEFELMT
RRMKQGVGNPMADVEGAAFDNPLADHHSAGTFNNPLNPMSAASVDASAGQHVYNNSTLSA
ATALSIAATKRTTTARPSTVVMREDVDLSRLTDKELMQIENPLYMTEEESDFSNPLARSA
TLTAKKRRPDGAGPSSGGIISASDLMAKGGNVQAFSSHGDNPLSHASDDGDFSNPLRAGR
Download sequence
Identical sequences A0A0D2WIL1
CAOG_01119T0 XP_004365990.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]