SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_02355T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_02355T0
Domain Number 1 Region: 219-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.0027
Further Details:      
 
Weak hits

Sequence:  CAOG_02355T0
Domain Number - Region: 170-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_02355T0
Sequence length 366
Comment | CAOG_02355 | Capsaspora owczarzaki ATCC 30864 hypothetical protein (367 aa)
Sequence
MRSPITVAVVALALLAVASPWTMTGVEAVRGLPKSSNVLRNAGRSGPSQTLDRCDACRKA
VREISTRMTDTAGKNFGGGNTAWEQSRFSAWATSEVRLVEVMDSICSDKMEFSCRQFLDD
HEEHVEKWFYHHQSEPMDRWLCSETSRVCCEHGHVGPQCKPCPGGPTNICNGKGECKGMG
SVDGSGECKCRDPYKGRDCTQCKPGHFRRVLNDNPDQPRVECVKCDPSCKACTGEGRQAC
KSCAQGFYNTTEAGCMECDPACQSCTDAGPSSCIACSEGYAKDPVNCADVDECATKAHSC
RTDQICVNTPGSFHCDCPTGEQDLNDACVPTIQPEADASDFDVSELSVDDDDAAEAQPEV
APHSEL
Download sequence
Identical sequences A0A0D2X1P8
CAOG_02355T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]