SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_02764T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_02764T0
Domain Number 1 Region: 808-916
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000013
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 2 Region: 131-168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family EGF-type module 0.009
Further Details:      
 
Domain Number 3 Region: 301-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000164
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  CAOG_02764T0
Domain Number - Region: 923-965
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0447
Family Growth factor receptor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAOG_02764T0
Sequence length 1354
Comment | CAOG_02764 | Capsaspora owczarzaki ATCC 30864 predicted protein (1355 aa)
Sequence
MARMCLPRAAAVLVQVVAVALALSTMLAAPSVSAATTSGCGAATSATVFRAVTVNTVSNE
FQSTPSVSGSEHVRGSLSQITPRTPIVDFGNASSVRFSLLPANGSRFMAERTLNMDSFQF
IIDETYVAYRNNCLPNPCLNGGQCVEGVNQFRCICPATATGTTCQLVYSAVVNATTCPTA
QQFFTNTKTKAIIVGNFFNYTMTPGVAPTAAVVLTFASSNTSVATVQPSTYTIPVGSIVP
VNISVYGVVPGSINISVTISSLDPLWNSTAVPRTQLSVFAVNTTIPNNLVNGTNTTSPTV
YVCCDPQLNPCLNGGSCVARADRRTYQCTCPPSFTGLHCGTPVWLVPTYYPKYQGADNVS
ADVCVSFDGLVGPPPEYRTNNVGFSLNGIYIRMAMSLNFVKRDTSERKGISFTAMHITLT
PRIPLMRNITKAVVTTVTNTTTNETTTITTNVNVPLPPTYYERWIGTSYFDGSTPNLRAD
QMTPFLYFLPDSITWQSQVTRDSPKPVALGQAFPDRLTQSLTPTGPGQEAYVSSISLERG
LIQLPRWRGIDTPQLFNYAQAVAQCAALPSASEAYPYHVCSQAELAATSARLNFSSCDAG
WLSDTTTVMVSNGAGGFDAVARRLAGFIMTYVDPACGNATGFFGMDATTNPAGTGYFEES
TTYRSVFCCAVSPVVDLGYYISTSYRLVAPQNHMFGLTFYPQYTSLSLGFTTRSRNTTRL
RRRDPSLDVCIAFEDFSSTLLPRVTAASGTLDLDANVLQIDADLTLPGCRLVGVQVDWRT
GAGAPLSVFPKQQLCQRSCNSSFAAPLVVSSFSGTFDDGSAGIEYSNNLACAWRIAPVAA
ERLTLRFNYLWTESNLDVIEVYDASTDGSDVGRLRGTFSGHQDVSALAPIVSDGPELILR
FTSNPSQTYPGFSVAFDGCNSIRRCTGHGTCNSDGGCTCDYEYAGPECRSCYLGYKPSVP
DQCTDGLLRAECQCILPPKDNGVRVKLRIRLDYSEVYSFEPAFIADVANSLDLVPSRISR
VVVLSVDSTGFAQIEFFILPGRGLRPAERSTALTVQLNTEFSALRTSTWGSRIDPTFAAV
LATLEMTQCKDGVYREKCPAPLVPKPTEEDTLYLYALAGLITGLIVGVLGVAYAIWRLRT
AQSRHMQRDAKQSLQREQDAREASEQRERERQEALAEAERAFAESQNAMSGAGVEDVSVN
LGPSARPSAVSTTGTTSAQSASSRDKGASSGLGRLFGGKKASATSSSAAPASSSSSSSAA
ASTSRQPVIPTALSNSPGADRQSAAASAKYIEAYELTPMSPRESLPEYEPRGTSADPIIN
PFRVSTDSGAPAAQMQRGAYKSKVVFDADSSLLM
Download sequence
Identical sequences A0A0D2U9D4
CAOG_02764T0 XP_004349517.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]