SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_03180T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_03180T0
Domain Number 1 Region: 45-295
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.66e-19
Family Lipovitellin-phosvitin complex, superhelical domain 0.0046
Further Details:      
 
Domain Number 2 Region: 3803-3947
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 2394-2480,2513-2593
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000268
Family Fibronectin type III 0.0055
Further Details:      
 
Weak hits

Sequence:  CAOG_03180T0
Domain Number - Region: 2656-2823
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000136
Family Fibronectin type III 0.0099
Further Details:      
 
Domain Number - Region: 1614-1689
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000199
Family Fibronectin type III 0.0058
Further Details:      
 
Domain Number - Region: 4019-4148
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000816
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 3764-3806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00214
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 4168-4294
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00261
Family Fibronectin type III 0.0066
Further Details:      
 
Domain Number - Region: 3052-3084,3126-3151
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0236
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 3500-3532,3587-3750
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0665
Family Glycosyl hydrolases family 16 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_03180T0
Sequence length 4741
Comment | CAOG_03180 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (4742 aa)
Sequence
MPPLHTLSIDSIRAKTIVPVPEAHWLALTMRHLDCFHQHPDPGSAIRAHCFSNLYELVQT
LSDDNMTLVATEVFDVVNDAVHRMTFIETLGAVGTPRAQLLLLQKVLLADDADIEEVHKT
IMTLHDVKRPTDETIRVLEAMCFHAGTEAFAFDLNYYSTTRKMALLALGSVIKNVHAYNP
QHAEELLALLHDELDTHEGEMARRGVGTHDDDGAISMQTQHKSTVVNALGNAGHSFSADT
LVAYATSEDEAEHVRSAALQSLRHLQSPEIDAVLLHALNDSGTVVRSAAHHAFTSMRRSV
TLPAETASGEAVHTGPHRERRLSLKQILDWSWRFELRAPGFLYKIGFGSDKMGAFVKAES
RNNILIHLSILKSYLSFDVYNEGAAYVAAFGKTIYIFRLLLAYIAWWGYDFEMIRKFGLE
DIFNIKALFDKIVNWVKDKIEMVKNFVSTAIDRFKSIAQSVVNAVINIPNAFMSMFEKIG
AMLTGQTAEVSKTTNATRKDEAYLIQIMIDLTFEFVSDVIGMNLTFVIQSVKTDLKLLGV
DSNRGVVMIIDAVRLFFECPIGAIIGVIQGANDIRLALFSTNTTAGWGLVPVAAKIIDET
GILSGSIPPWLTTIPDQAYVLLDEVTNYIEVCVNMILNPLTIATSPYTCFFKDSANEIVA
IMNKIEYNKQWLLNITAYYMQVYENVTNTFRTIKSYILKVKSIIEGFFGPKFSKAFPFDP
WQDTDAPSCADGIFTEDKNLNGTTTKPAGSSPPDNDPNVGGGYATEGKNTYTDAEDPGID
IALAGVIDIVAPWQGTVKATGFNWIVIAADSSLNQYDIKVQHFSPKSGLKSTYVKSGDII
GKSSGKSCANNHVDPVVRVSMKRKVPSPLAPTFVDPTKYLKRRIDIGLMMKETLNQFLYV
QLTKTMVDLYILPTKGSFSKKNTTTTGGGTTTKRRSAFTIRTDPGADDIAPYGSGIARRG
DNTCADFQGTSDVCLKFEKKNIVTYSIPLYAYAFNQVFGPVTVIAEFGAFLELGIDVWIQ
LCLMNKTCHAILTPHAGVAIKAKVVLDIGIAIAGLEVKGTILDIGLPIHGIVKFAKMPLD
ICVQLDMYIIPIAFYFSAFLRINLFGARVTVFDSVVFQWASKPIRFDAFLSNCQPKPDTS
PPQFTKPLQCKQLPDLAPDSPQVFCEWATEDPDTGVASQQWCGGSSPGACDLWAYEDVSG
DNYVAQRTHDESLLYVTLRAANKNGVAGTQTSAVIPFDKSVPMIRVFDGNATSAYLTTLY
TARAMQRFQDQATAQYDVLDYMRPLVEVQWAVGTSPVAKVPAIPLMSDVIPWTNVTWTPV
LTGSKSVGELYAPPERFLFLMQHNTKYYFHVRARNELNYEEAVASNGFLVDLTPPDVGVV
NNGGQLGFHLFATQLNSVVSVNWAGFIDNESGLHAAEFQLSSKCDCSVFENATCEFGDIV
PLSFSESYEVSKFRMMNPPLPDGFYYWRVRYENWVGLWSPFACRPFVIDTTPPLWRGPCV
SNEQCMVMTYDVETNSITARWQAYDPESDIKLYQFALGLDETDTSLMPWTEVYLNTSWVI
PNPPSGVKLVGKARAYNWVDLPARTFSNTLLIDSTPPIPGNVNDGGTLFVDVAYQKSTTE
ITFNWDSFTDPESGISGYYLVLGSAPGREDIKSLDDLYPDTFLSTRTAFLEANQTYYVTV
IAKHNGALGLTANASANGVLVDMSKPGEEQELYFNTPINVLDGSVTDGNLDREYQAAASA
LSARWPTILDPQSQIYTIEVAYVAEGDPSEPENLLWLSVDNATSSSALNHLALQHGAKYF
FFIRVTNGALWTITRMSNGVVVDLTMPLLHYLNDASDVLDLDYQSGTDSLSAYWLCEDPE
SDILNQFYSVWMGLPSVQMIGTVGELNENRGWAWTTSDTLVGIAHKARVVVDAVPLTGLT
VTPGNAYFFQVTIENRANLQTILATDGVKIDTTPPVMNYVFDGLEKPDTMLQYTNNTMFG
HWSAIDPESGILFYHVAIVDLGITVDDNYNPLPGKSPLVVTDWSDLCNSGSSAASKTATL
AWTEGSSCTNRNGVSMKLHRAFEQTAESYGIFKLDVAHQLEQKHSYYFLIYAANGALTES
LPMVSDGGVLIVQAPSPGTIYDGPVGGELQFQRHDSVMTAWFEGFASPAYGFTAFEVAIG
TSTNASYEFDVLEFNDDPILITSKSDVNGAGMLTIPIPMQQGVKYFVTIKGITQERLPDG
TWLSVMAISNGIAADSLSPVFADLDEGNHIAPVDYYQIGNDTLLTSFTVYDGHSCVGYNG
TSKTCAYSDLRPLEYSVGTAPGFGDIVARRPTPAEGSATKLVLRPGAEFVDDAAANNASL
NSIAVPEHGAPFIFNVFAVDNLGQASALSSHGLTVDKTEPTLGTVSCGPSIQADTTRFAC
SWVDFLDPESGIMYFNFSMGVSPGDTSIVDGVLTSDSTYLALNLNLTQGSTYYGTVRAVN
SVGLSSSSSAPGVFIDVTPPVAGRIIEIGDLRNIQRFRDTMDLSNLDSFDDGCQIVNDRI
TIRFAGFFDPDGTPIVQYTAAVGTTRGGVQTKSFTVLNVVQFGNVSEAVIDGMVLSPQTT
YYVTLRAFNYVGNFATAMSNGIRVSFYPPQPQFAVLQDYEPGYNDEFGQPIDKEFTSSLD
TLGVRFVMNEGCDPSYLTYSIRIVTYNEDRVVMPWKDIISRPGAVFGVQFEALNLTNTYK
YKFQVIATNQLGFQAYGETDGIQVINGGPPTPGVVMDGSTGIDVDFQASLTTINACWKDF
IDFDGSNITQYSVAVGTDPRFDATIENVMSWRAVGPVHCFKSPSLTLTPLTQTYYFSVRA
QGKFSLYSTASSNGVKAGFGQAQLQLEITGTPEEFDSYQFALRQKVADDVRARFPALTNF
DANNVIIINVHAKKLFDLSHASLLTAGQDVANLNGTASGNATDASSASRRHVGAPDPVVP
LHELTRRDEDFVEDTDPITELATNSTIILIVFDYPSTEERLGITDAEFTDSMVQEFDDLA
HQECVGPSGPVDCLSNTLGLTVSQVALDLNAPTVGNVYDGRTLFVDVDFQSDNSTISVSW
QNFHHDEGVIRYDVAIGFDPMPVYQPVNSSRWLLKNNGTDFEVLNMTTVTECPKTVTVDR
ICLPLNHVTLRNLTLYSNTTYYVSVRAVSRIDTESIATSDGIQIDMTPPSAGSQRFMTGS
PPLLPPTLSDTIIETPIISDKVRFQADPTQIVLDVSNFTDAESGMAAYYYSIVKYPRQQC
LVYPMAADSQAVALTLPFDSVAAVSTYTWPLYLPSDNSASGAIPRVYFPVLSNDTADVLL
NNIMSVNGTTFDGLFNRTTWDTQLAMTGLSMQPEYVYYVSLFGVNGAGLPTYTHSRALVA
DATRPVAGAIFDGASALSDIQYGSDKTKLVLTFAEAPTVATLACPALSYPLDGPHADFTL
TDRFWYDVIQTDTGTLSDIVLPSYEDAVYQELNVVATEVRPTAAVFTSGELYLSLRNVNN
VTHPRWVGAQYYKQDHLTSNGVYKVRMAGAVGQGVVTRISLVNGDPLSLPFHTNERCASN
CFASPYVQGFGLIIFGAPTDVVNDKGVQSVVSGTIWATALNGMLTFQEFDFSFVNNTVNT
ADPATAASTVYSPYDMHEWQFVFRELQVSMYVDGEYVKQFTLPFKLSNASLVVDVFGQPT
DTLQVARAVLTDIETPTPEIDVCDGMDSFRDFESPILYYEWSAGTSLGDVDVFDFTRIAH
DNICLSCRNGPCDAEFCNSTCDADNVRVISATATGLLLAEYRRYCNIANGGCDVAAICTA
SNNSETYFVNCTCPVGYTGNGTYCNPEIQCEPGVPYATHVTCSHDAFCTNLVGSFTCTCK
PGFYGNGTHCEDMDECSAVYQQYDKYKCHPAAVCTNGPGNFSCACRTGYTGDGRFECINV
DECLLHLDSCSGNASCVDTIGSYECLCDDNYFGDGFTCTPAGDFCSNPLWLATPERGSHI
RQRGNAAAYTPYDLTQMTHCGPGLTGSRDQQYLPLVRGFRSVLGRYTLELRNLGAFVDDC
ACENNGTCDSLTGHCSCTINYTGVRCASVAVRSWCDEGGADLCSEYASCVDGNTDGTAGP
VTGSCVCNVGFEGDGVFCSNENECVTRNFPPDLECDAIARCEDTFGSYKCSCPGGYMGSG
RGTGTCVIDPDAVEPYPVDDLDKIFPITYYIALRAVNAAGLSTTVYSNGITIDTTPATFQ
YIDMVSPFPSPGYELAPIHAQRYTEDMSFRWLFKDAQSAVVMYRMKAGTATSDTELTDWV
DFPAAITSHRLTGLSLVTNTMYFISIEATNGAGLRITYPSNGLLVDNSGPDSAAGWVIDT
YGAAIACELNGGASLTSTDDRTWSTDRFNMAIAFGDFVDNESGIKSYDWAIGVTPGGEEI
MPFTEAGASASPTGSMFALVTRSLPQIETGCGVPGPDGLVNAICLNDRSTYWVIGHSIYF
RNFQLATPRTYYNTLRVWNNVGMSIVRSTNGINVVDSSSCLTLGCQDESTVTCGAASVTP
TPSSATPGPAATTTAAAAPSASATPVAPVSHWAKVNMTVDGSPFSGDYVLVTAQLTDLDI
NAFSSSSATSSSNSTTVDFRRVIDPATIPPFQTYLEFTAMARAFSTSTNVDVDVQPTNHY
RVLLQWDADYFNITASVEQPDVVVYDRVKSRWIEASSTCASPHRIVTANTIEVHVCVTSQ
LAFVKTALAANTPAMSCQRSGCSGVVYVEAAGAPPVYCNCDSSCRTFGDCCLDHYDSCPQ
A
Download sequence
Identical sequences A0A0D2UAW3
CAOG_03180T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]