SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_03338T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_03338T0
Domain Number 1 Region: 49-178
Classification Level Classification E-value
Superfamily PH domain-like 7.75e-26
Family Phosphotyrosine-binding domain (PTB) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_03338T0
Sequence length 260
Comment | CAOG_03338 | Capsaspora owczarzaki ATCC 30864 predicted protein (261 aa)
Sequence
MSLSVDEDPEKRKRTSSVGRFFENFKHRHENYGKLERTSSVEDIMKVRSPEGRVFNVVYY
GTMEADESTGKAVTARALQFVEQNPSKRKMTMKVSTQGITLVDVETKITVEAHMLHHISQ
CAYDTSPDHYKLISYIAFNKEKSKYFCHVFKHEPTAAAIHEAISVAFEEAFKNYSANKKA
ATPAAPAAATAPLTTAASAASAAGSSPAASAPRSTPSLTVSNGEDGFDGLARQRTASGSG
RPPVRQPSPTPVSTGNLIEF
Download sequence
Identical sequences A0A0D2WP44
CAOG_03338T0 XP_004364177.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]