SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_04086T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_04086T0
Domain Number 1 Region: 118-316
Classification Level Classification E-value
Superfamily vWA-like 5.93e-35
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Weak hits

Sequence:  CAOG_04086T0
Domain Number - Region: 571-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000239
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 534-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00343
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number - Region: 481-509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_04086T0
Sequence length 812
Comment | CAOG_04086 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (813 aa)
Sequence
MLLLVSCISSVEVSALTVEDCTALELQSCNACLSKTSSCGWCKSTGACMLNTDGTAQCPQ
ASWINPTGQLLPNNVPGASAGAFQPSPSASVFSPANGTAQLRMGREFTFDITVTPVQYPP
VDFYLLLDASSGMFSDIHTLQQLRTNITEWLASQSPSVRFGLGVFVEKPVQPFTDPDVAW
PPANLPTQNVQHLLNFTSDPLEFHAALQAVQVSSDLDAPNSVLDALSQIALCPSIINWRS
DARQIVFVLTNDGYHLAMDGLRARIETPFVPTCQLVQQPSGAFVAPMTTHDYPSVAEFVR
AFSPSGVVPIFGVPASRPHLSWAYGRPNGLVEQLGHGAVVQLDERATNLMLRLQQGYRAV
ANSVHIYDPSGNAIVRRVQPSSASVLDVTGAQVATSVTVSVTLFTPTRLTAPVTLGLRAS
GQPASFPIIVSDGALVACTSGCVGATCANNCFNRGACDCGRCANCTGGYSGSQCQTRVED
ACPLINGLACSGHGTCQGFGRCKCDDGWQHGVTGGAILEATCSCSTASCPVDANGLLCGN
HGSCSCGRCVCEGAWSGIDCTCDSSLSCPASAKNCGGPARGACECGACRCIAPWYGEDCS
LCTPGESGCPLTTTSICQTFSNDCAACATYSDDYNTTCFWCNDIMACLPSGNEQTCQQIV
TAALVGDCRCLSDCENDVFVRYTSDNTQSYAFTQTADTDPGPVIGLAAGCMILMGLFVLL
VARLIVHQQANQEWKRFYQIRSDMQSGKGKPRNTTSMIHNELYEGNTPKSKGKGKASKSS
DESDAPKKRKPASGDAKPKRPHKRRSDSDDSD
Download sequence
Identical sequences D7PE21
CAOG_04086T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]