SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_04103T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_04103T0
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 2.46e-18
Family PG0164-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAOG_04103T0
Sequence length 183
Comment | CAOG_04103 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (184 aa)
Sequence
MPPVSFRAPLRRPANNPSQSEPWWFVVLPTESSASLPRRGRTTVTGTINGRAPFQATLEP
DGQLSHWLKLNDELRRAAGAEEGDTVAVELRPVETEPEPQIPDDLAAALAAAPQAARDAW
NQTTTIARVDWIHWMTSAKQPRTRTKRVADACDKLASGKKRVCCFDPSGHYSKAFCAPEA
ADE
Download sequence
Identical sequences A0A0D2VR31
CAOG_04103T0 XP_004347928.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]