SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_05058T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_05058T0
Domain Number 1 Region: 116-366
Classification Level Classification E-value
Superfamily vWA-like 8.45e-18
Family Integrin A (or I) domain 0.0013
Further Details:      
 
Weak hits

Sequence:  CAOG_05058T0
Domain Number - Region: 516-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number - Region: 685-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 19-51
Classification Level Classification E-value
Superfamily Plexin repeat 0.00445
Family Plexin repeat 0.0052
Further Details:      
 
Domain Number - Region: 487-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family Integrin beta EGF-like domains 0.032
Further Details:      
 
Domain Number - Region: 717-747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number - Region: 894-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0698
Family Integrin beta EGF-like domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_05058T0
Sequence length 1056
Comment | CAOG_05058 | Capsaspora owczarzaki ATCC 30864 predicted protein (1057 aa)
Sequence
MKLFAALLLLLALASSAYGQACTDILTCNECITGDSIYGCSWCVADGTCRSPSDNALLCP
NPAGVLNPTSNIRSTTNVANADGVVEIRPTTAVVELRKGVPQTVSIVVTIPQRKEVEFFY
LFDLSGSMGDDLRNVKNLGNNLRDKMQSLCRGSSSISSDCHYWRLGSHVDRPNGPFGGSG
DYEFRIEGIASGDDRSFGSFGAFSTALGNAATEWGNDFPESQYSSMLQSLLCVNWNPARR
HILLLATDATGHMEFDSNRLSSATAFPQRRALQKCHVTPGTASSSSNFANTINAATLDHE
IPSWPQIKAAFLDKNVVPILAITAYSSNNDHYDSFINALGFGGRAGLSGDSSNVLSVIES
VYNQIVGTIKPQLFDNGMDKFVRSLTPAAGYTGLSRGDSRTFTLVLEDDELSIGYNIAAA
DVRVVFLGLGESRITLVPSTCNCPVGTCPGACSSPGTASCECGRCNCAPGWSGPTCSCNN
PAGTCPNACSGRGTCVCGACQCNAGFTGASCECIDSCPTFNGVRCNGQGTCVCGQCQCNA
GYNGTACECAASATVTCASLNSCSGHGVCTEASTSGSCIATCRCNIGWSGPKCDCSSQCA
NTDCNPPRGQCVCGQCQCATGWDPATNCSCSTASCPRDQNNVECGGIGTDPLSHASACTC
DKTCVCKGGWTGPACNCSTRCPGNCNGHGTCNCGVCQCDSGWSGVDCKCSSNTCPVGTNG
LECSGFGTCICGQCVCDALHAGPACGCVKGVCPSVGGVRCNGGDCDPICGICTCPPGKTG
PACDCDTVAHPCPTGNSTSGVVLPCSGQGTCLQSSATQCGICLCNRDPLTGTPLYTGSDC
SCPTSGCIKVGGQQCNYPNGECDGCKCKCKPGYGTPETGCSCKIGVTCPVNLQNQTCSNH
GTCDTCNGVCICEAGYTGRLCNRPDPDPCGAATNCDACSRRSNPGCVWCDDNNLCMAKSA
AIAECYAKYANGTCPTSGLSDEAKAGIAGGVGGGLAAAGLLALLAYKLYGMLMDKREWQK
FEQGRQASQWKSDNNPLFQSSVKETENPLYQGDRSH
Download sequence
Identical sequences A0A0D2WRB3 D7PE19
XP_004346743.1.32957 CAOG_05058T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]