SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_05254T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CAOG_05254T0
Domain Number - Region: 318-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0289
Family Integrin beta EGF-like domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_05254T0
Sequence length 620
Comment | CAOG_05254 | Capsaspora owczarzaki ATCC 30864 hypothetical protein (621 aa)
Sequence
MTAYTTTSAATAAAAATAAAAVVVLVAALACPGLAQQSIVAGVPVLSALNSTAGPQRFVL
WYSGADNVAYRVSASFSNLATLSYTRDSTTVCCDGVQGFAQPSVGWTCPYNPSPAAAARP
AYEVITIAAVAGSSGASSVVNYALVVQELTIANLKLPNGIRVAGILDPYQSQTYVIYPGS
DTFMLSLQVAVPNSGLRLFVGINACPSRSQNPLVTLTSATTVTRVLSYALSSADPVYLTV
ALPRPASASTSSSVAHYSIGYCSEMPCVILDRGDCPAGCSGHGQCISDNTGFDSCVCNPP
WTGAEDCSIPIVACASDCYGRRECVQGACVCQKGYAGANCDPITSCLRTDKCTSHGVCIG
MTCHCDDFHEGEDCSQKRLFIGYSSSSDSISGTVLGLSCAGLIVLLTIVAFVMLANSIHI
RRIDARATRVVLEPGAPPPPRRTRPTTREPMSSEAADAAAGAALSGIIPNATALLQHWRS
LFGDAPPRAGYSVQLDDLEQPPEYTPTIAHPTTSADSSPTVPRPLPRATSVDGTHAPAAP
VSSTHSYPPAVAARPSMLDAVHAAQQLAHRLASSSGNSGASLSPDISLIDLMHSEGSERE
LTLRELPPSYDDSIGAGSPP
Download sequence
Identical sequences A0A0D2UHS6
CAOG_05254T0 XP_004346939.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]