SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_05309T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_05309T0
Domain Number 1 Region: 613-752
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000416
Family Type II chitinase 0.035
Further Details:      
 
Weak hits

Sequence:  CAOG_05309T0
Domain Number - Region: 936-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00598
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 97-323
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0316
Family Type II chitinase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_05309T0
Sequence length 1101
Comment | CAOG_05309 | Capsaspora owczarzaki ATCC 30864 predicted protein (1102 aa)
Sequence
MIRSRRTLLHNAAVACFVAAALLAAATSTQAAYSTASQKKMPTATTRAMWVWESWPTLRV
KANVAPFLDFFQKPFGHTEYAYNRILLSPGAAALTSDQAALRYFISQAHLRGIAVEYLDG
QNTWAQDSDKAVAKALCNTVLSFNTGTTTQDDDFDGIHLDIEPHTLGAIWRQNTGAGKDR
YNDNLEDNTMEVYASCRASINAQDPKVTLAGDFGDDYSYYVTDLWGAIMSQKVHDYVAIM
NYYDTQASFISGNAGVGGLVQNLANAKIPVLFGAETIMPPYAPDESSFWQEGYGHIEKLF
QNVYPTYRSSANFAGFATHHYNSYKLMSYDLVGTLGKEAFPGGAPYGSGSGTGSGSGTGT
GTGTGTGTGTGTGTGTGSGSGSGSGTGSGTGTGGGGVVLPGVRSCQLVNNQLIVSNLASN
VKCVQRDDTYEAAGPDASGKTVFKNVPKLCNVELYSSLDGSKDCSGYLGNIDCVVGSGEV
EPGKPSSTPGAVKPGKPTSTAGAVKPGKPTTTAKPPPAQATSSIKPGKTSSAPPPVVRPG
SKLMPNGATTRAMWVWELWPTLKQQANVAPFVAWLQAPHDDPSLAFNRIFLEVDTTALTD
PAGAQQLRYLLTELHKVGIAVEFLGGNAQWVMTANKEVPKQICDDLISFNLGTTATTDNF
DGIHLDIEPHTLGASWRQNTGAGKDNYNDEYQNNYVEIYSYCTAAAAARNPALTVAADIG
ADYAQYVTDLWNAVQAGGVMDYIGIMNYYDTQDRFVNGEDGIGGVVKNLALASKVPLVFG
AETIMTPFAPPAASFWQEGYGYLELMFDNVRPMFADNPNFGGLAIHHYDSYEMLPYDLLG
TLTGEEVSTGTPKCEYINGQIIVSNLAKTVQCVQREDTYDALTPDSNNQVVFTNVPKLIN
VETYFTMNGERDCSVYLGNIDCTVGSSDGSEPAPTCDACVHGSCVNGKCSCQSGYTGKDC
STPVVAPCVCSYEQTAPELAAPLRRREEGGRYTYARRNAAVYSAPGSATYDSSTGDGSDN
GLIIAAVTGWGVASVGVIYASVMAFKKKQAVQRVRKASIQAQSAYRPVSSRRDSLASIPE
ADPMAMADDSDFTALRRSSTV
Download sequence
Identical sequences A0A0D2WRT4
XP_004346994.1.32957 CAOG_05309T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]