SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_05532T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_05532T0
Domain Number 1 Region: 1443-1728
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-70
Family Protein kinases, catalytic subunit 0.00000348
Further Details:      
 
Domain Number 2 Region: 997-1150
Classification Level Classification E-value
Superfamily CalX-like 3.79e-27
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 3 Region: 606-728
Classification Level Classification E-value
Superfamily CalX-like 1.83e-19
Family CalX-beta domain 0.0076
Further Details:      
 
Domain Number 4 Region: 750-875
Classification Level Classification E-value
Superfamily CalX-like 2.62e-18
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 5 Region: 251-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 6 Region: 1127-1248
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000523
Family CalX-beta domain 0.0073
Further Details:      
 
Domain Number 7 Region: 884-966
Classification Level Classification E-value
Superfamily CalX-like 0.00000000118
Family CalX-beta domain 0.012
Further Details:      
 
Domain Number 8 Region: 210-246
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000818
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 416-511
Classification Level Classification E-value
Superfamily CalX-like 0.000000667
Family CalX-beta domain 0.0099
Further Details:      
 
Weak hits

Sequence:  CAOG_05532T0
Domain Number - Region: 509-620
Classification Level Classification E-value
Superfamily CalX-like 0.000419
Family CalX-beta domain 0.02
Further Details:      
 
Domain Number - Region: 157-211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0105
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_05532T0
Sequence length 1753
Comment | CAOG_05532 | Capsaspora owczarzaki ATCC 30864 tyrosine-protein kinase ITK/TSK (1754 aa)
Sequence
MGSLLTQKTYINANQEYGNINVNPWQGVNIGATTGGDYNIPAVQVYYRAMCDTFFYGTRC
SEYCRVNDPPACTGCNTQTGVCTCSVGYGDKDCGTCTPNYYPNGVSGQPGFFCQYCLAQN
NAAACYTCQTNGAKSCCVGWKNTNCDTKKNCGTFLLPPANAVAVTSTCQCTTYGCTCQYT
CKPGFTGGSATTTCMNNELWTWSSTLACNDIDECAPGGGNQCAQICTNTIGDYSCSCNSG
YAISNAGRGPNGCVDINECSTHNGGCGHICNNALGTYYCTCQAGWRLQPNSRNCTEINEC
QEGLDNCDGNAICTNTIGSFECQCASGFSGNGTVCTDVNECSTSPCDEHASCTNYAGNFT
CTCAVGYEGTGFECAIKSRASFAEDSRFMLIPDGGAGMSSTINLRVEMVPEVNGTPVFFN
VSSVGATVGTDYLVATASPLMFNLADTHKNISIVLIGSDRSATIQSIQVQLQGASSQFTT
ATIVIDAHDNQTGVVRFAEESRAFRVDITAGTYSLTIERYSYASLVKAINVTVRCDFPVP
QNISIVIPANQAAATKVIQLPFSSVPTLDAEHTYTIVDAMVTGSGSAAAIGYYSTSRVTV
NAHDDPYGVFGFSLTHVSVAESSTGFVQLKRLKGTLGTTVVRVRSLTLSSGQTNGVGIAS
PSDYAAVSQLVTFSENDVEAHVSIAVLADGVPELDEMFGLLLEYVSGPGRVDATLALALV
TIPENDNARGVLSITRVSSCFEESPLVGGVPQPNNTVAIEVIRSGGLYGAIAFTWSMHSG
RFKNTTLSADNRASAPEDYTALSTQAVIIAAGVDRAQIEVMLLDDEIPELDEYFWVQLDS
ASYGATIDPVSNFTDVCIGMNDNPFGALAFESVSLTPSATGESRLLVRESDVVTVAVSRV
GGTFRRVSGVVSIAHETTSSADFADSSARTVTFEPGQSTALASWTISADSAQEPTELFKL
VLTANGASAGQEATFLVGATSLDSTIPCAIEAQDGVNGVLSFVQPTVSVVEDDGKVTLTV
QRVGGSATAVSFQATAMPLSASGDDFDASNQNNSYTLAVGETSVSFDIQIEKDAIPELDE
TFTVTLVNVAGATLSWTSVATVTILKNDDVNGVVEFAPSSGQNPLVTIVSEDAGVIRLSL
WREVSQVGLVTLSFVLSTNVTSDPAFAPLSGLNLPSRFADLTLDVTTAPFMVTFEDGQNQ
TEIVLPLHDNGLLDGGRVLFVRLANVQGGARLGTAQAMAILIRDDESSAGSQPDSNSAPI
GAAVGAAAGGILFVLVLVIVIGMLRRRGRSRQSAIPTSKPLPAAAEPTYEAVSRNHMYAN
ALLTSGGTYDSPQQQQQQQEDPYEFLPQIVRNANPVYAEAPTYEALARNPALDDTYDSPQ
QPTLVPSIPDKPRALNSANRASVPARVVSTAGAPDFGAMRASFAGANANANVPSESDYDA
LYITTLDSFQREQQFSRNELQFTTQLGAGNFGEVWLAHVPARWLSKHARGSDSSGATTAA
VAVKTLKSDATDKSKSDFASEAQIMRRFSHPNIVSVVEVFVEQEPWMLVLELLVYGDLRN
VIQSCSSRGLVPTVGEYLHIFSQVASGLSYLAELHFVHRDIAARNCLVGTDLVVKISDFG
LSRELDEQNYYRMQTRGALPVRWMSPEFLLFRKSSPASDVWALGVLMWEVMSAGLSPYPG
IEPKALVDFLEKGGRLPRPDHCSDPLWQAMSNCWMWEAENRIDARQLHAAFAHMAAQHSG
GVRDLGALLASAK
Download sequence
Identical sequences CAOG_05532T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]