SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_06234T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_06234T0
Domain Number 1 Region: 1516-1804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.62e-69
Family Protein kinases, catalytic subunit 0.00000411
Further Details:      
 
Domain Number 2 Region: 1111-1263
Classification Level Classification E-value
Superfamily CalX-like 4.84e-26
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 3 Region: 719-841
Classification Level Classification E-value
Superfamily CalX-like 3.27e-19
Family CalX-beta domain 0.0072
Further Details:      
 
Domain Number 4 Region: 867-987
Classification Level Classification E-value
Superfamily CalX-like 4.45e-18
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 5 Region: 363-488
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000091
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 525-622
Classification Level Classification E-value
Superfamily CalX-like 0.000000000824
Family CalX-beta domain 0.009
Further Details:      
 
Domain Number 7 Region: 1240-1361
Classification Level Classification E-value
Superfamily CalX-like 0.00000000157
Family CalX-beta domain 0.0086
Further Details:      
 
Domain Number 8 Region: 997-1079
Classification Level Classification E-value
Superfamily CalX-like 0.00000000471
Family CalX-beta domain 0.014
Further Details:      
 
Domain Number 9 Region: 316-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  CAOG_06234T0
Domain Number - Region: 624-732
Classification Level Classification E-value
Superfamily CalX-like 0.000484
Family CalX-beta domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_06234T0
Sequence length 1817
Comment | CAOG_06234 | Capsaspora owczarzaki ATCC 30864 tyrosine-protein kinase transforming protein SEA (1818 aa)
Sequence
MATQFWSIFVLVCFLVGSAHAVQYRATCFARALYFTQASGCGEPTCDPYCTGWVKFAPNG
NASWNAGEQESHSPRWNIDINYGIVNNWAGTVQWFVDCEDIDPWPNTNDDMGSRTFNPIT
LNGNEEQGSLTTNPWQGVDLGGTIGGVYNIPAVYVYHRAMCDQYWYGARCGEYCKVSDPP
ACTACNSPSGVCTCSVGYTGKDCESCVGPNYWPVGTPGQAGFQCVYCKNQNTAFACYTCG
TGGIKSCCDGWTGPNCDIPNLCGAFPTPPLNSIAVMNATSCNCNTTGCMCTYACKSGFSG
GSATTTCLSTGPWSWSSTLTCTDRDECAPGGGNQCAQICTNTIGDYTCSCNSGYSISNAG
RGPSGCTDLDECSTNNGNCGQNCNNVPGSYHCSCYDGFRLQGDGKSCSEIDECQEGLDNC
DGNATCTNTIGSFECACYAGFVGNSTVCTDVDECATLPCSEFADCANFPGNFTCTCQIGY
AGNGVQCVFGNSAAFAESSRFVLLSDGASSATSPIQLRVEMVPEFDGTLVPFNVSSLDLI
LGVDYTVETPSPLVFNLGDTFKSITIVVIGNDDPEPLRSLFVQLQDSVSAFNKSTIAVDA
NDNPNAVVRFAEESRAFRVDITAGTYPLTIERYSYASLVNAINVTVWCDFPVPQNISIVI
PANQATATKVIQLPFSSVPTLDVVHTYTIVDATVTGSGSAAAIGYYSTSRVTVNAHDDPY
GVFGFSLTQMSVAESSTGFVQLKRLKGTLGTTVVRVRSLTLSSSQANGVGIASPSDYAAV
SQLVTFSENDVEAQVSIAVLADGVPELDEMFGLLLEYVSGPGRVDATLALALVTIPENDN
ARGVLSITRVSSCFEESPLVGGVPQLNNTVAIEVIRSGGLYGAVSFTWSMHSGRFKNTTL
SADNRASAPGDYTALSSQTVTIAAGVDRAQIQVVLLADSIPELDEYFWVQLDSASYGVTI
DPVSNFTDVCIGMNDNPFGSLAFERVNLTLSATGESRLLVRESDVVTVAVSRVGGTFHRV
SGVVSIAHETTNSTDFADSSARTVTFEPGQSTALASWTISADSGEEPTELFKLVLTANGA
SAGQEATFLVGATSLDSTIPCAIEAQDGVTGVLSFVQPTISVVEDAGKVTLTVQRVGGSA
TEVSFQTNAVPLSASGDDFDASNQNNMHIMAPSQTSVSFDIEVSKDSAPELDETFTVTLV
NVTGATLSWMSVATVTILRNDDVNGVIEFAPSSGQNPLVTTVSEDSGFIRLPLWRELSQV
GVVTLSFVVTTDLSSDPVCASLSGLGLSSAPANLTRDVDAAPFVVTFGDGQNEAELAILL
HDNSLLDGSRVMFICLKDLQGGARFGASQAMAIVIQDDEHDTNESSSAPVAAAAAGAAAG
GVVVILIVLLVIGLRRRRGRSNFSGASKGKQLSGASDPTYEAVSRNRMYDNNLRVPDDTY
QPVQQTVVQEDPYESLPQPTAPDESLFNTVNPAYEKVTEDNPDFDAMRASFRPSVPVDNY
EDLYIASVTAFQQHQRFSRHELKLSTQLGSGNFGEVWLAHVPSRWLEKKSRQSLSVSATT
VATVAVAVKTLKAGASDKSKSDFASEAQIMRRFNHSSIVSVVEVFVEEEPWMLVLELLPY
GDLRKVIQSCHARGLTPTAGEYLHMFSQVASGLSYLAGLRFVHRDIAARNCLVGADLVVK
ISDFGLSRELEEQNYYRMQTRGALPVRWMAPEFLLFRKSSPASDVWAFGVLMWEVMSAGV
LPYKGVDSKAIVQFLESGQRLSRPPLCNDKLWALVSSCWSWEVTDRVDAAQLYAAFTRMA
FDNPELDSVRDLGALLA
Download sequence
Identical sequences A0A0D2WUV8
CAOG_06234T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]