SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_06751T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_06751T0
Domain Number 1 Region: 1401-1688
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-67
Family Protein kinases, catalytic subunit 0.00000298
Further Details:      
 
Domain Number 2 Region: 783-949
Classification Level Classification E-value
Superfamily CalX-like 5.67e-30
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1033-1189
Classification Level Classification E-value
Superfamily CalX-like 2.35e-27
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 4 Region: 660-783
Classification Level Classification E-value
Superfamily CalX-like 9.94e-17
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 5 Region: 300-427
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 1163-1288
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000497
Family CalX-beta domain 0.015
Further Details:      
 
Domain Number 7 Region: 257-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000389
Family EGF-type module 0.016
Further Details:      
 
Domain Number 8 Region: 431-556
Classification Level Classification E-value
Superfamily CalX-like 0.00000183
Family CalX-beta domain 0.026
Further Details:      
 
Domain Number 9 Region: 200-262
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000567
Family Complement control module/SCR domain 0.002
Further Details:      
 
Weak hits

Sequence:  CAOG_06751T0
Domain Number - Region: 104-205
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number - Region: 31-74
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00171
Family PLC-like (P variant) 0.059
Further Details:      
 
Domain Number - Region: 565-694
Classification Level Classification E-value
Superfamily CalX-like 0.00262
Family CalX-beta domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_06751T0
Sequence length 1706
Comment | CAOG_06751 | Capsaspora owczarzaki ATCC 30864 megakaryocyte-associated tyrosine-protein kinase (1707 aa)
Sequence
MDLRATTVREPPLATVFRTTEYSGSVAKLQDDNNPVWEQYFTTSQVNNYPGSFKLELEFY
DADFLSNQILGSIVQTYTAGSSAAYIPITVNNPFASAYWIKFAYRVICHADYYGPTCDTY
CTTSTGSCSACDPASGACTACKSGYTGTPSCSTCATNYYPSGSGSCVYCVPNDGGYYTCS
STGTKVCTPGYTGASCNTLVSCPTAPAAPTNTTKSQCSSVSANSTCTYQCNTGYSISAGS
PNITCSTTGAWAPTATTLRCVDTNECNNLNGGCNQTCLNTPGSYDCSCLTGYTKNGDGKG
ETGCLDNNECSSANGGCQHTCTNLPGSYACSCNSGYQLQPDAKSCININECTTGMHNCAA
NATCADTIGSFTCTCKAGFSGNGTHCDDVNECNGIPFPCSSDALCTNTPGNYSCACKPGF
LGNGLECAADGRVAFDVSSRFLVVRRPESGTSTISLVVEAPVQVDATVQFSISSASLTAV
SSAPLQFSSTVHQQTITLNLAASGSALAQETIDIQLASPVNMALDDHFNRSQIVIEASQS
QFGTVGVSAGSRQISLSNVMANPEFSITLERFSAVSYASAVDITFSVTSTVASSTTFVAT
IPAGQQTFAVSITVPNMGTPTVPSTLTYTITAATAVTLGEATPIGYYGSSVVAVPEHDYP
YGLFSIANTASSWPEPSSASLTITRARGSVGTVTVRVTPYAVAFNTSTGTPVATIDLDFA
STPVDVEFTAGILTKNALVAILDDTIPELAEVFGVRLEIVSGGGAVDSTASNVLVTIAES
DSPHGVLAFDAATLAVDEPASDSSVSITITRTAGLFGDVTFAWATSITGSDHNVNAQAGL
DFVEGAGTVTLLQGHSSAVIQVVIRADSLPELDETFAVTLSSPTGGATLGAQSTITVTIN
KNDKPYGTIGFVTPTLTKSADGSARFLVTGGSTFTAEVARYFGTFGTVTGDATLQFTTPV
TAADFNNQVVRTVSFAAGQTSQTSNSFNVVAAQAPVRLFDIVLSPSSGSLATLDADAPSV
IPCAIEASNAVDGVVRFTSLTFIAQESAGVALVTVERTGSALGAVTFTYSVRTGTAGGED
FDASIQDAPVVIEAGAASTVISIAVDDDDIPELDETFTVLLTGITAGSAYLTYASVATVT
IAANDDPNGWIEFAPSGNPLGDDVYTVREDTPSLNIPVLRNGGRFGAVDVTVVAGTNASI
APFTAFLNRDHPDEGVSLTSDLHVTSPLVVHFAAGQSTASGALVLTILKDNVLEGAKALY
LALQDPTNGAQLDARNVIMVELRDGEDSAANSAAAAVPIAIGVVVGCAAVILLVVIVLRR
RKRARHQNQLLKATESGYAVPMQTVTIPSKGDASEPLYATATATYSNSAASATSGSANYD
TIDARRNPNEAIYDDAVPLSRIHTTPTAISNQLRNNLVLGETLGSGAFGVVVAGQLSLEF
VPQDAIYLCAKRNQSTLAVAVKQLAADATANSREDFFEEAQMVCRFSHPNIVRALAALLE
RDPNMCILELMPYGDLRSVLRNSLKDNVYWSAAEMSFALQQVASGLAYLETQNFVHRDLA
ARNCLVGAGLSVKISDFGLSRALEEKDYYHMETNGRLPVKWMAPECLNFRRFSPHSDVWA
YGVLAWEVYAYGATPYGNLAAGREVLAQVEAGLRPQKPESCPDAAYALLERCWDLIPTAR
PTASELQKFFAVGASEGAIRDIGAML
Download sequence
Identical sequences CAOG_06751T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]