SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_06964T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_06964T0
Domain Number 1 Region: 1466-1754
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-68
Family Protein kinases, catalytic subunit 0.00000469
Further Details:      
 
Domain Number 2 Region: 1061-1213
Classification Level Classification E-value
Superfamily CalX-like 7.72e-25
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 3 Region: 688-810
Classification Level Classification E-value
Superfamily CalX-like 6.93e-20
Family CalX-beta domain 0.0063
Further Details:      
 
Domain Number 4 Region: 836-967
Classification Level Classification E-value
Superfamily CalX-like 1.31e-18
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 5 Region: 345-469
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000107
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 1190-1311
Classification Level Classification E-value
Superfamily CalX-like 0.00000000196
Family CalX-beta domain 0.0095
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000243
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 959-1067
Classification Level Classification E-value
Superfamily CalX-like 0.000000275
Family CalX-beta domain 0.012
Further Details:      
 
Weak hits

Sequence:  CAOG_06964T0
Domain Number - Region: 529-591
Classification Level Classification E-value
Superfamily CalX-like 0.000144
Family CalX-beta domain 0.017
Further Details:      
 
Domain Number - Region: 593-702
Classification Level Classification E-value
Superfamily CalX-like 0.0017
Family CalX-beta domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CAOG_06964T0
Sequence length 1773
Comment | CAOG_06964 | Capsaspora owczarzaki ATCC 30864 tyrosine-protein kinase transforming protein SEA (1774 aa)
Sequence
MAAQYRATCTAYLKGMKVPGGCGSGDGTCDTLCSSSAQFAGASTVSKSLGEIDDTITPNW
NTYYYNNVVVNNFGGQIVWWFDCEDYDPWNANDDMGSRTFTVPMNTNADYGSVSSSTWYD
LGGTASGTFPVQNIYVAFRANCDANYYNSTCAEFCQVGNPPACTACNAVSGNCTCSVGYT
GKDCESCVGSNYWPVGTSGQTDFQCVYCANTSLPTACYTCGTGGVKSCCGGWTGPNCDIS
NVCGAFPMPPLNSIAVMNATSCNCNTTGCMCTYACKSGFSGGSATTTCPSSGPWGWSSTL
TCTDRDECAPGGGNQCNQICNNTIGDYTCACNSGYSINNAGRGPSGCTDLDECSTNNGNC
GQNCNNVPGSYHCSCYDGFRLQGDGKSCSEIDECQEGLDNCDGNATCTNTIGSFECACYA
GFVGNGTVCTDVDECATLPCSEFADCANFPGNFTCTCQIGYAGNGVQCVFGNSAAFAESS
RFVLLSWALKCFLNLTVFLSSLTCLRWISSSALITLWRPHLRWSSISATFKSITIVVIGN
DNPEPLRSIFVQLQDSVSAFNKSTIAVDANDNPNAVVRFSAASRAFRVDITAGTYPLTIE
RYSYASLVNAINVTVWCDFPVPQNISIVIPANQVAATKVIQLPFSSVPTLDVEHTYTIVD
ATVTGSGSAAAIGYYSTSRVTVNAHDDPYGVFGFSLTQMSVAESSTGFVQLKRLKGTLGT
TVVRVRTLTLSSSQTNGVGIASPSDYAAVSQLVTFSENDVEAQVSIAVLADGVPELDEMF
GLLLEYVSGPGRVDATLALALVTIPENDNARGVLSITRASSCFEELPLVGGVPQLNNTVA
IEVIRSGGLYGAISFTWSMHSGRFKNTTLSADNRASAPEDYTASSSQTVTIAAGVDRAQI
EVMLLADSIPELDEYFWVQLDSASYGVTIDPISNFTDVCIGMNDNPFGSLAFERVSLTPI
SRVGGTFRRVSGVVSIAHETTSSADFADSSARTITFEPGQSTALASWTISADSAQEPTEL
FKLVLTANGASAGQEATFLVGATSLDSTIPCAIEAQDGVTGVLSFVQPTISVVEDAGKVT
LTVQRVGGSATEVSFQTNAVPLSASGDDFDASNQNNMHIMAPSQTSVSFDIEVSKDSASE
LDETFTVTLVNVTGATLSWMSVATVTILRNDDVNGVVEFAPSSGQNPLVTTVSEDSGLIR
LPLWREISQVGVVTLSFVVTTDLSSDPVCASLSGLGLSSAPANLTRDVDAAPFVLTFGDG
QNEAELAILLHDNSLLDGSRVMFICLKDLQGGARFGASQAMAIVIQDDEHDTNESSSAPV
AAAAAGAAAGGVVVILIVLLVVGLRRRRGRSNFSGASKGKQLSGASDPTYEAVSRNQMYD
NNLRVPDETYQPVLQTVVQEDPYESLPQPTAPDESLFNTVNPACEKVTEDNPDFDAMRAS
FRPSVPVDNYEDLYIASVTAFQQHQRFSRHELKLSTQLGSGNFGEVWLAHVPSRWLEKKS
RQSLSVSATTVATVAVAVKTLKAGASDKSKSDFASEAQIMRRFNHSSIVSVVEVFVEEEP
WMLVLELLPYGDLHKCIESCHARGLTPTTGEYLHMFSQVASGLSYLAGLRFVHRDIAARN
CLVGADLVVKISDFGLSRELEEQNYYRMQTRGALPVRWMAPEFLLFRKSSPASDVWAFGV
LMWEVMSAGVLPYKGVDSKAIVQFLESGQRLSRPPLCNDKLWALVSSCWTWEVTDRVDAA
QLYAAFTGMAFDNPELDSVRDLGALLAGTSSFI
Download sequence
Identical sequences CAOG_06964T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]