SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_07207T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_07207T0
Domain Number 1 Region: 2321-2374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000795
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  CAOG_07207T0
Domain Number - Region: 1756-1801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 1506-1546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 2002-2043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family Laminin-type module 0.04
Further Details:      
 
Domain Number - Region: 2062-2114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Laminin-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_07207T0
Sequence length 3184
Comment | CAOG_07207 | Capsaspora owczarzaki ATCC 30864 predicted protein (3185 aa)
Sequence
MPSSVSAPGVFAIFSAKVVAIGSAISVSTLAVGADGVMQDTDGNTFNDTAVFDFGALSTL
AFQPLEDREIIVQVQASVPSAATVGNVAGSTIESQATAFFGPDSSSLVSINSTLLSHTVA
EPNLQVTSIISPEVAYPGDDLTFTALVAHTAMSSTTAFALELLDLVPVGGNLTLYPDSIV
VTTSASVPVPATVSLSADNSTFSVMLSELPLYEAAGLSTKSTFNVTFVAKLVLPDATINW
VPAVNYSSSPLDFSSPSIFAGRNYTAWDVASASDNTPKLIGFNASLPLISSASPAVSGFV
ANAASPIVAVGDQVTFNLTASVPSGSIGSFKLAIAAGMPSSVSAPGVFAIFSAKVVAIGS
AISVSTLAVGADGVMQDTDGNTFNDTAVFDFGALSTLAFQPLEDREIIVQVQASVPSAAT
VGNVAGSTIESQATAFFGPDSSSLVSINSTLLSHTVAEPNLQVTSIISPEVAYPGDDLTF
TALVAHTAMSSTTAFALELLDLVPVGGNLTLYPDSIVVTTSASVPVPATVSLSADNSTFS
VMLSELPLYEAAGLSTKSTFNVTFVAKLVLPDATINWVPAVNYSSSPLDFSSPSIFAGRN
YTAWDVASVDAAAPPSSIASTQLSSAASVASAASAASTKVASTASVASAASVASTISGTV
ASAASVASTISASVASAASAASTKAASTASVASAASSASTISASVASAASVASTISASVA
SAASAASTKVASTASVASAASAASTKAASTASVASAASAASTISASVASAASAASTKAAS
TASVASAASAASTISASVASAASVASKQAASAASTIAASAASTISASVASAASKQAASAA
STVAASVASASSAASKHASLSASAASVASTISTSIASTRAASASSTPVASATSVPGRSAT
LISAIPNVVPSSIDGHVLLPVSFTYTGSNLLADGCCTILVTYANRGFPDMPAWTSGSIDA
TNNEFEIHNLIVTPDGSGTSGTVTATLSMTVDEKANNFTYVVSLASSTGATLLVSSAIFY
ADVPAYTLLQPAEFNILTMTKANGVQIFDAQGFRELRRRALAATVLTTLNYMSQVLSANG
DVVIGTTTTYDSRTAFDHRFGGVFVTLTGASICSQSELDAVVALLDAHLNAFAPYPVKLY
VISDFFGSTFTAGSQTLLVVARDVNGATANDFLLSADVATYLNNALTGSTASDLLTHGIS
ALTATSAQGRGLILTNEGFFLAGNGATLTAVRSAGPKLNDATIDSSSCNIVWQASVSGSN
TDNINGVATTFRQTCTNRQLIYRSLSSAFMLVTSPGLLDTRTLAFSLVGPVVLADSEYHI
GSGFAENVDMDETWSAERCAEYQPWATIGLQSVRACSEAAVSPTYRKLVFDLAGEFALKE
LYVTLPHYPLPYPVAESLATQPRHSDASSSLKSRLELWVASASGAWVDVTDSISDDFAAA
CTGLGKRDRPCKITFEVLSYLRDSQLGNAGIRYVSLVFDGIEDSTRRLPAALRVFEITEV
VALGTCLCNGHSASCDIADGRCDACEHMTSGHYCGVCSNTAFTNKRNSPDFAVNSCSYDS
AAMIDGVFACDGPPLAEIDPSEIESLFYDHGTFSGLIVPGVPVRDLSRAVFQKFFANGGP
CDPCTCFGHSNAEVTNNFAIRVCDADSGVCDCAASHNVHGDHCETCDATYCRDIPACSPA
AYAYEQCHIAGCFARCDCNGHSTLPQVGGFDQCEGDGCGCSCNAADGVTGAHCESCLPNY
FSSTGNGVDGETCEPCFCNGHKGSPDTCDVTGGNCDQVGDPCQDNTTGHNCELCLEGFFR
PFRPDGTIDLSDGCIACDCNGHGVGPGLCNPDGGVCSCNPSSNSEGDQCQSCIVGFWSAT
GTAEDGVSCTACQCNTHKDYVDNECNALGGDCMTDFDGNPQPCADQTNGTHCEHCNPTFY
RPCLTPIVSGVCGGVDLTYGCQACNCNHHAAIVVGGGETCNEVGGICDCAPSSHTTGNRC
ERCEENYQNPFGTGVYGSCFPCNCWTHSETCSAIGTCTNCRDNTTGVSCGDCFTNYKRNT
IYPDYDTPEGNKRNREQGCQACNCHGHAYPSSTTTGFGICNPNTGLCRSCGNHTLNGPLG
ECDTCVPGYFRQLTSAGFAAADDVCGACNFVNGKCSEDTLEDICRPCSEQCFGSNTMCGA
NTGVCSQCGLSNAESHRCASCQNGFFGNPSEGIPCTPCKCYHSAPSKFDLLTETEIGTFQ
QCLFDNSIGGVSGGAQSCILDHSVNAIDAAADPQSAILCSCPRSIPGGFFNIISSGVVYE
GRTCDSCNQDAYFGQPTQCLTPGAGGSGLGDCLSFDTCNECICNGNIDESSMMDNCDYSA
GNPSNLICKACLGHSTGPNCEVCEVGYYGDPTRLDTPGTIGTGFILDGSGESLKCFQCDC
NGHSIARVVPGTEGDVHNDTCTTVAPGFVGNYTCDCDSANGYTGPTCRECLLGYEQIALG
GNLFRCDPCDNCTRDAADIIYGLIDEYAALDTFESEIAASVAAVAVAINDLKAILGIARR
DASAANIVAALPLVGSTADCLTSQREQLSALLANFEASADNKMVRVRIQSLLKRVEDSKL
ASFTSQSESFQRLAAAADLLSTLIAKLPQQRERLASLESALAQAEAAFLHEQDWIDTNLD
VISAGLATADRMTQSAAGLRAAAAAAFDRSVAPLALVLSQAEAVLRDDTADALQSVLAQA
LADIQGRLTRLESVMSNVRTRTATANAASTTERLAQHQSTISALGARLALIEGQVGLDGA
IEQAHASLLLVLQAADIGTGEFVTMVDATETELRNKLAALDPTQAPHVSELIAELESSIA
AHRDAVAESSKRILTQVSAEASIAATAASESLISSGANEVARVVAVQTFLSKINTISNGA
VAQFTEAFAGERVLAIMRELVSSRRRRTVELLTPLERETFAAFGEAWSAAKYETMQSCAS
VLDQYTERLQASIAAFTKSLTRVQLNTTQVALDMTERDSMKNWLSGVAQELKMARTDSLA
ALDRKISARAGQLAASLDEVVLELSVSVGSVRNLAVAELMQASSKVADLPAIVAATVADL
TQQLANLVGEIDLSASQIQQNEQQELERFVGRFGSDMAIIRTKISAINELVNSLEDALNE
QADALDVSATSARATLRETAALQVNLQAFLTIPASAELVKEAPASPSATLVDQLRNTALP
QCQL
Download sequence
Identical sequences XP_004343931.1.32957 CAOG_07207T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]