SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_07994T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CAOG_07994T0
Domain Number - Region: 1838-1863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00628
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 410-670
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0195
Family Virulence factor P.69 pertactin 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_07994T0
Sequence length 2886
Comment | CAOG_07994 | Capsaspora owczarzaki ATCC 30864 predicted protein (2887 aa)
Sequence
MRSIPVATTLAVLLLLLVAGLFTSGATAASLTFASTTNSDWLTAANWNPAQLPTTNDDVT
IPNGFAVTYTTAATNFVKSITIASGGSLTINGASTSCQLTVSGTSTTPSNIAGTLTVSSP
AKLALSSGTGRLNIQATGLLVSNGGSFTGSGSVYNDAGGQVSITSSTTMSLPFYLQGTST
LAMSAGAPLTLTSTASILGGSVTSGDSLAVLVLQSSATVATSVSRIRVASSATFSGAASM
QVQSLEVAGGTATFAQAVNVTEQLLLRGGSINGASVLRATESSSVFIQPTNYMYVSGSVT
VELRGTTNYSSPTSPYYMTTDNTARLINYGWMEMRSTVADQIFVTGNAVAGSGFFNYGTL
SVAGMGVRLNGFFTHQGQLFVADSQLKLGGSGVYNGSVTLNSTLASMAFTGGSWTLWTVP
NNLLIDGATVGFWQDATLASFTLNSGTVYVEKAIVVTTSMTLRTGNFYYSSTPGSITAAA
TSQVLIQPTSVLGLSYLPLILNGTTTFVCGSASLYLYNDGRVKNYGWLNVVASPGFPSML
SWYPAGTVTGFYNYGVMNISAPTPVTLGAPFFNLGQIYVANGIVNLANGGLQNGTVTLNN
TQASFVFTGGAHAVWRGVDPIFLDGGTVSVAQDQTTGGLIMNSGSLYVNKQLTILSSMTL
RGGSFNYDSSPGSVIAAASAQVLIQPSIGYIYLYYIPLILNGTTTFICSTYSLYLSYDGR
LINNGWMNVVAAPGLPSMLSWYPSGSLTGFYNDGVMNVSAPTPVTLGAAFFNRGQIYVAS
GTVNLANGGLQNGTVTLNNTQASLVFTGGIHVLWRGVDPVFIDGGTVSVAQDQTIGSLIF
NSGSLYVNKQLTVQTSMTLRGGTFSYDSAAGSIIAASSSQVLIQPSIGYIYFYYIPLILN
GITTFISSSYAVYTGYDGRLINNGWMNVVSTAPATMLGWSGVTADSGLHNYGTLNVSVSA
SGPLVFAAAFKNFGPVYVANGNLNLAAGGVQNGTVTLNNTQASVVFTGGTHFLWRGVDPV
FIDGGTVSLVQDQTIGGLIFNSGSMMVNKQLTVLSSMTLRGGTFSYDSAAGGIIAAASSQ
VLIQPSIGYIYVYYIPLILNGTTTFVSSSYAVYTGYDGRLINTRWMNVVATAPTTMLGWA
GVTADSGLHNYGTLNVSVSASGPILFGAAFKNFGLVYVANGNLNLAAGGLQNGTVILNNT
QALVVFTGGTHFLWRGVDPIFIDGGTVSLVQDQTVGSFIFNAGSMMVNKQLTVLSSMTLR
GGTFSYDTAAGSVTAAATAQVLIQPVLSYVYLYYIPLILRGTTTFIGSTYSVYTGYDGRL
VNNGWMNVTSSFTTTVLGWSGVGADSGLLNYGTLNVSSPAPIYFGAPVSHHGVSTLAGRV
IFSAGGRMNGTVSFYDATSMLWFTAGVFDVIVAPSRFQVSGTTTVVPRSAITVQQLWIDS
GVLQTNYDVVVTDLCTIQGGQITYSVSPGRLYLTSSSRTTISIASAFTSNLPIYSYGPAT
WITADGGTSFTLTSPGRWLNFAPLTMNRTSAAFTGTGGFYNYHNITTLQSATISPSIFVQ
GGTMQVVSGTQTASFTSVLANATMDVAAAGTLAVSTATAWVAGSTLRGCGTVTAASSVAL
RGNIVPGCSAAASILTWTGAMSMAATTVTSIQVYPGPVMSSLVVSGNVALNGNASFEFRD
GFTVAPGQYVNNRVLTANSVSGSWLSSSSLLTVVTLINTVNVTLNATGSCTNCSAITGVC
DVINSQCACVANYHGSSCECPGNATHACNGHGACSPFVTACACDTGYWGVSCANSCPGGV
GPSTCSGHGTCSQANGLCTCTTGYGGTDCQCPSSSSAQICSGHGTCAAGVCTCAFGYFGL
DCSGVCPGGFSTPCNNHGVCNSLTGACDCSSSGYSGSACEIPPVSTTPFSSTPVVSTTSS
ATPVNSEQSSASSTVGASSTPASSATSQTPFSSTPFSSTVPSSTPSSATPVSSNTPIPTF
CPYGYYGPVSGCASICPGGATTPCTNHGDCDYVTGVCTCTDPDFGGVACSCPARAGQVCS
NRGACTANPSVCQCSSLSWGGPACECPAHLGNTCNNHGTCMHDGQCVCDPGYWGADCSIH
CALPPGAPCDWCNPANSCPTTPSAPFFVFTGSALSFPTNFGTFGSGSGYLVHGGGSGGYL
IQGTTSPSVVDYACATNAAPVAFSNGTVAELSVRISASNFYNCPANNTCVGSFSAVIADS
DSDTVVYLSLGWNVIVLSNGTHTVAAYNNTSLRHTYRISLNQTGNGLVTLDYDGVPLLQL
PLTLTFLTNPSPRYPRGSFCIGDDSTDYGGESLLQYIWVAPSALASTTACDYIPADSQAE
CSSVDPQCYYCGASGSCSDVLASNISSCFFDAVVEEVVLFPIPMSADQRQAIEYSTGALN
FFIVFVIVLVSIASIQDSPEHPELQSDVWNFIDRVQRVASMGFLRAKLPESFVVYTGMMA
WINCHIDILGTSFQEYDPVTGERRLLDIDQVVSFLGMDERQLIFNTLLIIGVLLALVLVV
AIILVIGTSLRLCCAPRLDRKLSRAAKLRALARHYTPATMLRVLALAYYGLCLAVFAQLT
ISGATSYQTNAFVASVISLVALVAGLPLLWWYIIVYRNKLDVKHQLGPRFGKSEKKPKKK
SKTDSDAGKPTEKDETPKQVAHFDKRFGVVYGTYNALNRPFGLAFMVRKLVFAILISTAA
ITLRVQVGLVVGLNLLLLLLWIGRRPFKSKFEFWSESVGCILDCISFLLLLAYDPNQPSG
APTAAEAALIISYVAIAVQGSSVLWSTMTVIRTKIANRRHRRAMAERGDVAVVEMQQNDL
VNPLSQVSKASEAQAVHIESVYESTPVAAGVSAQADPIYHSPSDALPSSDYETIAKQDES
AQAHWV
Download sequence
Identical sequences XP_004342595.1.32957 CAOG_07994T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]