SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_08103T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_08103T0
Domain Number 1 Region: 1465-1753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-69
Family Protein kinases, catalytic subunit 0.00000429
Further Details:      
 
Domain Number 2 Region: 1059-1212
Classification Level Classification E-value
Superfamily CalX-like 3.66e-25
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 3 Region: 812-937
Classification Level Classification E-value
Superfamily CalX-like 4.97e-20
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 4 Region: 668-790
Classification Level Classification E-value
Superfamily CalX-like 3.14e-19
Family CalX-beta domain 0.0072
Further Details:      
 
Domain Number 5 Region: 312-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 474-571
Classification Level Classification E-value
Superfamily CalX-like 0.000000000929
Family CalX-beta domain 0.009
Further Details:      
 
Domain Number 7 Region: 1189-1310
Classification Level Classification E-value
Superfamily CalX-like 0.00000000353
Family CalX-beta domain 0.0089
Further Details:      
 
Domain Number 8 Region: 949-1067
Classification Level Classification E-value
Superfamily CalX-like 0.00000000497
Family CalX-beta domain 0.014
Further Details:      
 
Domain Number 9 Region: 264-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  CAOG_08103T0
Domain Number - Region: 573-686
Classification Level Classification E-value
Superfamily CalX-like 0.000863
Family CalX-beta domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_08103T0
Sequence length 1766
Comment | CAOG_08103 | Capsaspora owczarzaki ATCC 30864 tyrosine-protein kinase transforming protein SEA (1767 aa)
Sequence
MATPTGMRLPFGNANWNAAEQESHNPRWNIDINYGAVSNWAGTVQWYVDCDDNDPWPAPD
DDMGWKTFDPITLNGNEEQGSLAASPWQGVNLGSTADGEFNIPAVYVYHRAMCDQYWYGA
RCGEYCRVSDPPACTACNPSSGVCTCNVGYQDKDCGTCQSNYWPVGTSGQAGFQCVYCVD
TNTASACYTCQAGGVKSCCTGWKSTNCNVKKNCNSFVAPPANSVAVGSTCVCTTYGCTCQ
YSCKSGFSGGSATTTCQNDETWRWSSTLTCTDRDECAPGGGNQCAQICTNTIGDYTCSCN
SGYSISNAGRGPSGCTDLDECSTNNGNCGQSCNNTPGSYYCTCQPGWRLQPDGKTCLEID
ECQEGLDNCDGNATCTNTIGSFECACYAGFVGNSTVCTDVDECATLPCSEFADCANFPGN
FTCTCQIGYAGNGVQCVFGNSAAFAESSRFVLLSDGASSATSPIQLRVEMVPEFDGTLVP
FNVSSLDLILGVDYTVETPSPLVFNLGDTFKSITIVVIGNDDPEPLRSLFVQLQDSVSAF
NKSTIAVDANDNPNAVVRFSAASRAFRVDITAGTYPLTIERYSYASLVNAINVTVWCDFP
VPQNISIVIPANQVAATKVIQLPFSSVPTLDVEHTYTIVDATVTGSGSAAAIGYYSTSRV
TVNAHDDPYGVFGFSLTQMSVAESSTGFVQLKRLKGTLGTTVVRVRSLTLSSSQANGVGI
ASPSDYAAVSQLVTFSENDVEAQVSIAVLADGVPELDEMFGLLLEYVSGPGRVDATLALA
LVTIPENDNARGVLSITRASSCFEESPLVGGVPQPNNTVAIEVIRSGGLYGAISFSWSMH
SGRFKNTTLSADNRASAPEDYTASSSQTVTIAAGVDRAQIQVMLLDDEIPELDEYFWVQL
DSASSGVTIDPVSNFTDVCIGMNDNPFGSLAFESVSLTPSATGESRLLVRESDVVTVAVS
RVGGTFHRVSGVVSIAHETTSSADFADSSARTFTFEPGQSTALASWTISADSGEEPTELF
KLVLTANGASAGQEATFLVGATSLDSTIPCAIEAHDDVNGVLSFVQPTVSVVEDTGKVTL
TVQRVGGSATEVSFQTNAVPLSASGDDFDASNQNNMHIMAPSQTSVSFDIEVSKDSASEL
DETFTVTLVNVTGATLSWMSVATVTILRNDDVNGVIEFAPSSGQNPLVTTVFEDTGFIRL
PLWRELSQVGVVTLSFVVTTDLSFDPACASLSGLGLSSAPANLTRDVDAAPFVVTFGNGQ
SEAELAILLHDNSLTDGSRAMFICLKDLQGGARFGASQAMAIVIQDDEHDTNESSSAPVA
AAAAGAAAGGVVVILIVLLVVGLRRRRGRSNFSGASKGKQLSGASDPTYEAVSRNRMYDN
TLRVPDDTYQPVQQTVVQEDPYESLPQPTAPDESLFNTVNPACEKVTEDNPDFDAMRASF
RPSVPVDNYEDLYIASVTAFQQHQRFSRHELKLSTQLGSGNFGEVWLAHVPSRWLEKKSR
QSLSVSATTVATVAVAVKTLKAGASDKSKSDFASEAQIMRRFNHSSIVSVVEVFVEEEPW
MLVLELLPYGDLRKVIQSCHARGLTPTAGECLHMFSQVASGLSYLAGLRFVHRDIAARNC
LVGADLVVKISDFGLSRELEEQNYYRMQTRGALPVRWMAPEFLLFRKSSPASDVWAFGVL
MWEVMSAGALPYKGVDSKAIVQFLESGQRLSRPPLCNDKLWALVSSCWTWEVTDRVDAAQ
LYAAFTRMAFDNPELDSVRDLGALLA
Download sequence
Identical sequences A0A0D2X5M6
CAOG_08103T0 XP_004342704.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]