SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_08370T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_08370T0
Domain Number 1 Region: 747-898
Classification Level Classification E-value
Superfamily CalX-like 1.19e-23
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 2 Region: 502-657
Classification Level Classification E-value
Superfamily CalX-like 3.92e-17
Family CalX-beta domain 0.0055
Further Details:      
 
Domain Number 3 Region: 252-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000143
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 390-513
Classification Level Classification E-value
Superfamily CalX-like 0.0000000115
Family CalX-beta domain 0.0087
Further Details:      
 
Domain Number 5 Region: 206-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000003
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 634-721
Classification Level Classification E-value
Superfamily CalX-like 0.000000196
Family CalX-beta domain 0.024
Further Details:      
 
Domain Number 7 Region: 927-997
Classification Level Classification E-value
Superfamily CalX-like 0.00000288
Family CalX-beta domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_08370T0
Sequence length 1247
Comment | CAOG_08370 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (1248 aa)
Sequence
MGRYNTPADHQAMNVNTDYGNVAAGTWYDLGGTTGSDDLSVYHIYVAYRANCDTDYYNNN
CGEYCHAGNPPACTDCNPSTGYCICNPGYQDKDCGTCSTNYWQVGTSGQPGFQCVYCLGQ
NTASACYSCQAGGVKVCCDAWKGTECNVKKSCGAFPVAPANSARATDGTSCTCSEYQCTC
KYSCSAGYTATPVTSTCGFDEQWTTVAGLQCLDVNECAPGGGNLCAQNCTNTIGDYTCSC
MPGYNQNGDGRGEYGCTGIDECATAGQGGCAQDCTNTPLSYYCGCFAGFTLAPNGKDCTD
NNECTLGTHNCDSHASCTNTYGGFYCTCNAGFTGAGTAGTCVNTNECGQSPCVANAACVD
SPGSFTCTCNAGYTGDAYVSHNGWCAHVSAVSFADSSVMVVSKPASGNITVTLQVNASAS
VDLSSVQFSVVGTNATAGVDYVVLTASPLVFNVSDTSRVIQVAILSNSFTTNLQSLNIQL
HDPVHLVVDRFNNATVIINAAGTVRFAQASRAFSVNITAGSYALTVERVSASSLARAVNV
TIYLLPRNAMHRQRVIFPAGVDRMNLNVVILDDTVPELDEYFYAQLDGVPIGGAVIDPVN
NYTNLCIARNDNPYGLLGIELPSPMTLGPNGQHRFIVYEGGFVNVTIHRYYGTFHTVSGV
VSLVNENTTNADFGNVNNIAVTFAEGVSSVSVAWPIANDLANEPYEMFGVKLVANGASSG
QEATSVVTTSSLDSYLPCVIDASSSSGVIRFQDTLLSVEEADGAAVFTVVRELDGAGDVT
YSTNAMTGTAPGSDFDASNENNTHVLPLTDRTQQFSIRVAEDTIPEADETFFVSLVNVTG
ALVSWASVATVTIRANDDGHGVVEFAPSSEVTPVVYVAYQNATHIRLPVWREVAALGRIN
MTFEISTNRSSSPDYLALSTVYLPKSKVDMTRDIDPSTYEIVLADGQNETEIVIPVFDTP
GYQSTKYMFVRLKDIGGGARFGATRAVVVLIVDNVPAPNPSGASSVDAAIYIIIPSVIAL
FLLLLLIVVLRRRKRQKPVAVALMHRNDPAVGQIELNPLHQLNEERNDTYDDVRPGAREG
LYDTLGGGGGDGTLSNPTYDTNATYDSLGGHQSSEYESITKHYDNANDSKSQEVAPAYGP
GYTRVVGRSSSNADGDHAHPEQYAALDHGEDGVSADLNAKMREASGGDALPDYDNPTPAP
EYSNLGDGGAQTGPYSLPRSAAPAPLYSTPRPAAPAPNPNAEGSHYD
Download sequence
Identical sequences CAOG_08370T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]