SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_00015T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_00015T0
Domain Number 1 Region: 1122-1273
Classification Level Classification E-value
Superfamily CalX-like 5.49e-25
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 2 Region: 872-1012
Classification Level Classification E-value
Superfamily CalX-like 2.88e-19
Family CalX-beta domain 0.003
Further Details:      
 
Domain Number 3 Region: 746-861
Classification Level Classification E-value
Superfamily CalX-like 6.93e-17
Family CalX-beta domain 0.01
Further Details:      
 
Domain Number 4 Region: 364-488
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000022
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 5 Region: 502-623
Classification Level Classification E-value
Superfamily CalX-like 0.00000000981
Family CalX-beta domain 0.0084
Further Details:      
 
Domain Number 6 Region: 318-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000389
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 1250-1369
Classification Level Classification E-value
Superfamily CalX-like 0.000000103
Family CalX-beta domain 0.0073
Further Details:      
 
Domain Number 8 Region: 1009-1096
Classification Level Classification E-value
Superfamily CalX-like 0.000000693
Family CalX-beta domain 0.023
Further Details:      
 
Domain Number 9 Region: 614-761
Classification Level Classification E-value
Superfamily CalX-like 0.0000955
Family CalX-beta domain 0.02
Further Details:      
 
Weak hits

Sequence:  CAOG_00015T0
Domain Number - Region: 44-126
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0491
Family PLC-like (P variant) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_00015T0
Sequence length 1637
Comment | CAOG_00015 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (1638 aa)
Sequence
MVRTIQLLLAATVLVLTASSAHAVQYRATCFARALYFTQNSGCGDGTCDPYCWGWVRFAP
NGNANWNAGQQANTASPRWNIDLNYGVVNNWEGTVQWYVDCDDADPAGNPDDDMGWRTFN
PITLNGNQEQGSLTASPWEGVDLGGTTGGEFNIGAVYVYHRAMCDQYWYGARCGEYCRVS
DPPACTECKALTGECKCNPGYQDKDCGTCSTNYWQVGTSGQPGFQCVYCLGQNTASACYS
CQAGGVKVCCDAWKGTECNVKKSCGAFPVAPANSARATDGTSCTCSGYQCTCKYSCSAGY
TATPVTSTCGFDEQWTTVAGLQCLDVNECAPGGGNLCAQNCTNTIGDYTCSCMPGYNQNG
DGRGEYGCTGIDECATAGQGGCAQDCTNTPLSYYCGCFAGFTLAPNGKDCTDNNECTLGT
HNCDSHASCTNTYGGFYCTCNAGFTGAGTAGTCVNTNECGQSPCVANAACVDSPGSFTCT
CNAGYTGDAYVSHNGWCAHVSAVSFADSSVMVVSKPASGNITVTLQVNASASVDLSSVQF
SVVGTNATAGVDYVVLTASPLVFNVSDTSRVIQVAILSNSFTTNLQSLNVQLHDPVHLVV
DRFNNATVIINAAGTVRFAQASRAFSVNITAGSYALTVERVSASSLARAVNVTIYRSQPA
PQWFSVVIAVNQLTAVLTVPLAMSTAPSFDTVYTYTITNATLIGSTARPPYIGDYATAAV
TALAHNYPNGLIAWRAVSLVLQEGTGSYVTIDRAYGTNGSVTVRVRTVTLTYAQSGGVAL
ASTSDYTSFSQLLTFAEDVNTLSVIVSTSGDTQPEVDEMFGVLVELVSGGATVDPTKSLL
RITIAENDDAHGIISMTPVYTCNDESPIVGGVAQPNNTVKVLLRRAGGLFGDITFTWSTH
DGVFNNASLASQRNASGAMSDYVVANQQRVIFPAGVDRMNLNVVILDDTVPELDEYFYAQ
LDGVPIGGAVIDPVNNYTNLCIARNDNPYGLLGIELPSPMTLGPNGQHRFIVYEGGFVNV
TIHRYYGTFHTVSGVVSLVNENTTNADFGNVNNIAVTFSEGVSSVSVAWPIANDLANEPY
EMFGVKLVANGASSGQEATSVVTTSSLDSYLPCVIDASSSSGVIRFQSLFISVQESDGDA
ILTVSRSPNASSVTYSSDAVPGTASGSDFDASNQNNTHLLPVTDSTQQFSIHIANDNIPE
GDESFYVSLVNVSGAYLSWASVATVTILANDDGYGVVEFAPSTLFDTDVYHFYENATYIR
LPVWREVGAIGRINMTFEISTNRSASPDYLAFSRVALPSLKVDMAHDIDPATYEIVMADG
QNETEIVIPVFDIPRYQGTKYMFVHLKNIGGGARFGASRAVVVMILDLDSAPTSSGASSV
DAAIYTIIPSVLALLLLLLLIIVVVRRRRQKSKVAKVAPAFMHRNDPTVGQIELNPLHQL
NEERNDTYDDVRPGAREGLYDTLGGGGSSVGNPTYDSNATYDSLSAANYQSASAQYQSPA
GQYQSPAGQYDNFEAPVYDSAGDEKAPEAYAPGYTHIAGRTASDQLPAPPGQTRPQQYAA
LDHGDAGVSPEVDAKMLEAAGGHYDSFAPGTNAPPNYDNLPSAVNSDATASEYATPRSAP
PPVYSRPRSNPQDPVYD
Download sequence
Identical sequences XP_004364886.1.32957 CAOG_00015T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]