SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_01283T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_01283T0
Domain Number 1 Region: 65-341
Classification Level Classification E-value
Superfamily vWA-like 1.78e-33
Family Integrin A (or I) domain 0.0000591
Further Details:      
 
Domain Number 2 Region: 454-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  CAOG_01283T0
Domain Number - Region: 581-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family Integrin beta EGF-like domains 0.024
Further Details:      
 
Domain Number - Region: 546-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00067
Family Integrin beta EGF-like domains 0.04
Further Details:      
 
Domain Number - Region: 495-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number - Region: 426-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family Integrin beta EGF-like domains 0.022
Further Details:      
 
Domain Number - Region: 614-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_01283T0
Sequence length 1035
Comment | CAOG_01283 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (1036 aa)
Sequence
MCGWCGDHGQCQSAAGTCSNWQSPASRVLGTSGSTPEVSPTTTNVFLRAGQPLLVTVSVT
PQPCKPVDLYLLMDFSGSMDDDLTKVRSLAQPLATKVTQLCTDTSNPTCSNTNCARLGFG
SFLEKPAYPMGRWTTSGWIKDSTYTGGTSLPTNHAFRARLPLSYNLGQFVTLVQGISGIQ
GNIDTPENMIDGMLQAILCQKLIDWPSFNTTYQPRRLMLMLTDDTTHFRKEGYMAGIVEP
FPYKCYVPDSAFTLPSTNTNAVNRFIDDASTKYDYPSFSQLKNALIENNIVPIFGSTATG
INQRTFQDLVTALGFGQSGTLATNSDNLVQLLSDAYNSIASTIVAAVQSNGNEGFISAIS
PAAAVGYTNVVVGTTYKFNFTLLYDGTRARTDGNTIIVTFVGFSAVSIVVNLVNDCNCAG
LCPVNKCNGHGTCLCGRCTCDDGWTGETCTCNSDPMACPSYNGAVCNGILRGTCQCGTCV
CNEGFAGPACECPTTGCPTSTGDVCSGHGTCNCGVCTCDAAWNSTSAIDCSCPTVAPGCM
KPSGSGVDCENHGSCKCNQCTCRPGYTGTYCDTPVLPCPNSCSGHGNCTAGSCVCEPGWT
GSSCSCSTVCPDNCSGHGTCQCGVCRCQAGYSGLNCACNNNCPSRGGLTCSGHGQCNNCD
GTCTCDVGYQSKPDCSCSDAPCPNGCSGHGTCTCGVCTCSGLYTGADCSCWNVGCNSASN
CNSALGHGSCNCSQCVCTGNYTPETECLCDRTEHCAGWDGTSECSGHGTCVSDATQCHQC
KCDADAQGSPLYSGASCNCSLVECGGETINGFKCNQAAGNGECICGTCHCKNNFTGPSCE
CGPCSHDCGEHGTCVCGTCVCAPFWGPPGQCTWCDVTAVNNTCPHDSCTNYTSCGSCTDH
NDRGCMWCEDLGKCYNNTNGNVKNVCTGTVIRSNGDCPFLGDLPVGTTIGVFVGVFGGII
VAAIAALVALKLINGMRDRREWGKFEAEREKSRWKGDDNPLFKASTTGKKICCLFRVVRA
AGFEHEFAAVLASTI
Download sequence
Identical sequences CAOG_01283T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]