SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_02005T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_02005T0
Domain Number 1 Region: 228-473
Classification Level Classification E-value
Superfamily vWA-like 4e-19
Family Integrin A (or I) domain 0.00072
Further Details:      
 
Domain Number 2 Region: 594-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Weak hits

Sequence:  CAOG_02005T0
Domain Number - Region: 882-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 143-182
Classification Level Classification E-value
Superfamily Plexin repeat 0.000523
Family Plexin repeat 0.0058
Further Details:      
 
Domain Number - Region: 638-663
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number - Region: 812-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_02005T0
Sequence length 1189
Comment | CAOG_02005 | Capsaspora owczarzaki ATCC 30864 conserved hypothetical protein (1190 aa)
Sequence
MRCWTALLAAVALMLALSASSADAAVAPPTTICNAVDEYGGGMTLTCPTGQTISAIVFAS
YGLPQPSPFTVGTTPCSSMAYDPCNSRSSRSVVESFCLGQQTCTITNTNNAAQGGGGFNS
YFNDPCQNVVKRLYVSALCVDPNTCAALTDCKSCVNNLNIAGCGWCAQDGTCRSAQGDCP
AASYHNPSSTYTAAPISGTPEIYPAAANVTLRYNIPVVVPITVTVSTSKPLDLFILLDVS
ATMADDLATLKSFTQTAFSNSINKNCNGGTAPPSGSECAYVRFGTFVDKPVVPLGGPTDW
NFKIASQYAASSAFSRDFSIARSAVQEPTASTNGYSVNDRPNSFLDAAVQAALCSNWDPT
HRHMLLVVTDAPFHFAGDAEALSSAPHAVYKYAQQRCFTGTDAVWASTEYEYPTLGLLSA
ALLSEFVVPAFIVTNAASNNIYTSLVNQLGFGRADLSLASDSNNFLALFDAAYAGVANNV
LARVGDTDAARFVSQISPSTATTSPATFSITLLATANTQSITSATSTLEVVFPGVGSAFL
SIKLADCKVPLCDDACAALDCNVNGTTAVNCDCGKCVCLPEWTGATCSCLRANNNLPCPV
VNGADCSGRGSCLCGKCECDIGYTGDACNCPVAACQDNCNGNGQCICGNCVCNDGYFGPT
CNCFAGLDSSSGSCPVGSNSLECSGASHGSCDTSIINPQNNVCSGRCNCQSGWSGPTCEC
STNICDGGCNELCSELPGGCGTCNCGACQCALGYDPATNCKCLLGATCPVDENGDLCGGA
GQSTGCTCGVCQCTSAWTGPACNCSATPCNDNCNGGGQCVCGQCVCNAGWTGETCGCPVG
TTCPTDSNGVTCGGQGVCQTDSAATCGKCKCNPGYTGENCTCQNRPCPFTSNGLCNGHGS
CQCGVCVCDEGFVGSKCDCNAGSKPCPASSDGVACSGNGVCLHVDSSTCGVCQCDRDPVR
NLPLWNGLNCNCSTVGCPISGGIPCGRHGSCGACGVCTCDEGYTGADCSCKVEACPIING
RECNGHGTCGCFGQCVCEAGWYDQGCIFCNATILGDSCPGAICSNQTSCSNCTRLPECAW
CSAGGFCTYNESAIAGCSGPILHGQACSVDSETVDVGVVTGAAVGAALGLAFLIGLIALK
IVHTIADRREWEKFQRDKESMRWKGDDNPLFKSSTKEFDNPLYNASHQQ
Download sequence
Identical sequences CAOG_02005T0 XP_004348755.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]