SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_03512T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_03512T0
Domain Number 1 Region: 147-276
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.64e-34
Family cAMP-binding domain 0.00000357
Further Details:      
 
Domain Number 2 Region: 281-405
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.19e-29
Family cAMP-binding domain 0.00000667
Further Details:      
 
Domain Number 3 Region: 6-45
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000484
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_03512T0
Sequence length 414
Comment | CAOG_03512 | Capsaspora owczarzaki ATCC 30864 protein kinase (415 aa)
Sequence
MSSAEQRELEAYLAANNVHGFLKDLLVQICIDRPKDLVEHAIQHLSAKSGRTVTAPAPVA
ATSASGAAATSSIKPAPALSLTTPKIVEESEEDAKSDSDDDSSSTGRRDSIEAPVPAFAP
PKTLRRRGAVSASVMTEEDVQSYEKKVVPKDYKTMAALEKAIKKNILFSHMDDDERSDVF
DSMFLVEHKAGDVIIQQGDEGDNFYVIDSGDVDVYVAATGDQPITSISDGGSFGELALIY
GTPRAATIKAKTDTRLWAIDRNSYRRILMGNTLRKRKLYESFLERVPILETLDKWERLTV
ADALEAVTVENGVEVVKQGEEGNDFYIIVEGKARVLQRKNPEDEPLEVGRLGPSDYFGEI
ALLTNRPRAATVVAEGTLKCIKLDRGRFERVLGPCEAFLRRNISTYNSYIQLVV
Download sequence
Identical sequences A0A0D2WPI3
CAOG_03512T0 XP_004348417.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]