SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_05610T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_05610T0
Domain Number 1 Region: 404-554
Classification Level Classification E-value
Superfamily SIS domain 0.00000000000667
Family mono-SIS domain 0.00095
Further Details:      
 
Domain Number 2 Region: 79-173
Classification Level Classification E-value
Superfamily SIS domain 0.000000153
Family mono-SIS domain 0.013
Further Details:      
 
Weak hits

Sequence:  CAOG_05610T0
Domain Number - Region: 297-367
Classification Level Classification E-value
Superfamily SIS domain 0.000612
Family mono-SIS domain 0.0025
Further Details:      
 
Domain Number - Region: 232-276
Classification Level Classification E-value
Superfamily SIS domain 0.0325
Family mono-SIS domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_05610T0
Sequence length 640
Comment | CAOG_05610 | Capsaspora owczarzaki ATCC 30864 glucokinase regulatory protein (641 aa)
Sequence
MLPQSTVSITETSNELTSELDSAGADEIVRLLRCSDAQLFGGYRHYEGLMDETTIATLEQ
IAACISRNILHNRPAAGGRDADAAATTTTTTTRVVISGAGTSGRMAFVCASTFNRVLEKL
GLPKLFAYICAGGDSALFTSQEAPEDNWRAGIQTLVEASQNASKVVYIGITCGLAAPFVA
AQLDYCMQHLDVFTPVLLGFNPLHLARRIKVEQWHHTFASVCEQLVQVSFPQVEAAKAQG
FILTPIVGPEPITGSTRMKGGSATKIILDVMFVRAFQLAKLLGGGVESADQSVAALLQEC
LLAMQETYLQARAIGQVVQLAGDSLRSGGRILYLGSDSLGIMGLIDASECAPTYGATYDD
VRGFLHGCFDTLGNVEGNLHEKAAPAQQQLASSPGPSCATVGSATFDIGLGSFTRNMLPT
LSPRDLVIAIVSDNPSGRDAVYRTLEAASGRGSKTAVIACTGASPASAALQLPASALAAV
RVRLQRTSPISDGGLAASAPIHLEFAAKLVCNAITTGAHVLRGKVLGNHMIDLRVSNTKL
FHRAIGIISRFANVDEAMARDSLVRSIHTDSSALSELANLDISEHVRVATTSQRVVPRAI
VLAIAALRNQNLSAQAANAMLDSHPIVRDAVRHLLNPSRP
Download sequence
Identical sequences A0A0D2X3Y6
CAOG_05610T0 XP_004346283.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]