SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_06077T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_06077T0
Domain Number 1 Region: 1406-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 2 Region: 836-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.034
Further Details:      
 
Weak hits

Sequence:  CAOG_06077T0
Domain Number - Region: 585-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number - Region: 1148-1199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_06077T0
Sequence length 2246
Comment | CAOG_06077 | Capsaspora owczarzaki ATCC 30864 predicted protein (2247 aa)
Sequence
MKLANILFFVALASLISASAHGVSIVTGPSDKVVCAEQNVHLNLLVGETGGETNCCTATV
ERAIKNDDEWVAIPTVSATTTAVDASSSNVAIELAPSQVNDEFTYRITIETLDGATVTSQ
EFFLAFSLPAVLQAPETNVAAQSAISVTAQLTPLRQEPELSVIRFTNSGPGFLQFRQSSS
SVSDFEYEVVDNVNADTMFEILPTLTLDTSTILLVDQADADHFLEWLDAFFAQSLQYLSD
PIGASSVAIALRDFNGLSFTSTSTWLGIYTAAQAQIHDAGAIADFEAEFGGRTFTLLFSA
PTKVDVVVRNSQGSYLGWMTSPQSLTALTQIDATQCAHKWFLDNSRLKASCSSTRALSHL
LTAPLLGTAILPTSQIAIISQYTTSSRTTSAITDSTYSIGSGATSSAVGVWSSRRCQQVG
TSHLQSLLECAAQDDNPTYRQVHIELGAFGFGVKYVTIDLTHYPLPYPVDGPSAAILPRQ
SGHSTSTKSRLELWVALAPSGTWIDVTDSVTEDFTRDCVSRGQRQRPCRVTFDVLEYLRA
SDTILGNQAISDLRLVFDGIEPSSLDLDAAYRYFGISEVQAIGTCICNGHSSTCNYATGQ
CTGCEHHTQDDTCGSCDNKHWENRRNSLPAEVVNCDLAAPAVDNVLVCDGPALADIDVSE
LESLFFESGGRSGVIVPGVSARDLPSAIFSKFFATGGACVLCNCHNHSLADAGQNVRGCD
ASTGVCNCDPTTETTGDHCESCQATWCRSTSPCNNTPLSSSDLYACRLQSCSNERCDCNG
HSTLPQVGGFDQCDGNGCGCSCNPADGVTGPHCESCLPGHFSSTGDGVDGETCEPCFCNG
HKGSPETCDVSGGNCDQAGDPCQDNTTGFNCELCLDGFYRPFRPDGSIDPTDDCIPCACN
GHGVGPALCNPNGGVCDCDPASNSEGDQCQSCIVGFWSATGNAESGTSCSACECNGHKDY
VSNECNALGGDCMTDFSGAPQPCDGNTNDFHCQGCVATFFRPCTVGVPTACSAVDYTDDC
SPCDCNGHSVSPIGGLDTCNAEGGLCTCTSSSNSEGDSCENCKPNTWNDFGNSEDGRDCA
PCACYGHSATCSNFGVCSGCQGNTEGNNCEQCVASNSRVNPAAFVGWDLPTPDPAVITTM
REQDCTPCNCNGHSLNNPTIAPGICTPELGICLNCGGNTANGAANECDTCVPGFFRQLTS
AGFDPASDTCNACSLVDGDCTSDALTDACRPCSEQCFGANTMCGADTGICLECALSHAES
HRCASCQNGYFGNPAGGIPCTPCKCYHSAPSKFDLLTETEIGTFQQCLFDNSLGGVSGGA
QTCIFDHSVNPDDAAADPQSAILCSCPRSIPGGFFNIISSGVVYEGRTCDSCNQDAYFGQ
PTQCLTPGVGGSGLGDCLSFDTCNECICNGNIDESSMMDNCDYSAGNPSNLICEACLGHS
TGPTCEVCEVGYYGDPTRLDTPGTIGTGFILDASGESLKCFQCDCNGHSIARVVPGTEGD
VHNDTCTTVAPGFVGNYTCDCDSANGYTGPTCRECLLGYEQIALGNNLFRCDPCDNCTRD
AADIIYGLIDEYAALDTFESEIATSVAAVAVAINDLKAILGIARRDAGVAALPVMQSRLD
TVRAQLAELIASYSDAATDVHVNSRIESFLARVEASKASAIAQSAEFVRLQSASATLTAL
VAKLPAQRAQIEALVTLYDETAAAFEFSKTYLDANVDMLRAGADGAELAVASVAAMQGDA
AVAISATHTPLLALLDRATAVLGDEGKSHVEASLSSALGQIQARLDRLDRSILLLQSSSA
QARGAKTEALLRSHSSTISSLVSRLALLESSVGASGDVERLHASLDLAINSIASTLTAFH
VAAESAEESMHAALQELNPAQSPAVLKLFALLEAEIEGHREALLESSLQTLGALKEATET
AVESAARKLSTGVADVAVRTANVETILLGVNTATKSALSRLIAAIGSHSRFFELLETDDS
TSPLEREMFVAQSTMWVNAKIAIGQELTALLDALQTNLPEMVSSFLTRSTRIPLNLSQAP
LNLDSRDALLTELKNVAAQIQSEQTAALGQLESAISSRASALGKQLAFISAELRGSLSAV
RTRTLENLVELTSSVVALPGIADVTDELALIHSQIDELLQSSLSEQGDQETLAEFAARVR
VNLQEIASELGQIRQLIQEIESEIERQSQILDASALAAKLTLQQLSSLQTNLKQYLAVDV
DLSSASPLDAKLADSLNAAALPQCNL
Download sequence
Identical sequences A0A0D2WTC0
CAOG_06077T0 XP_004345667.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]