SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CAOG_06582T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_06582T0
Domain Number 1 Region: 1379-1668
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.75e-69
Family Protein kinases, catalytic subunit 0.00000341
Further Details:      
 
Domain Number 2 Region: 762-927
Classification Level Classification E-value
Superfamily CalX-like 1.05e-29
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 3 Region: 1012-1167
Classification Level Classification E-value
Superfamily CalX-like 5.23e-27
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 4 Region: 639-762
Classification Level Classification E-value
Superfamily CalX-like 2.22e-16
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 5 Region: 278-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000455
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 1142-1265
Classification Level Classification E-value
Superfamily CalX-like 0.000000000249
Family CalX-beta domain 0.017
Further Details:      
 
Domain Number 7 Region: 235-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 178-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000167
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 9 Region: 429-536
Classification Level Classification E-value
Superfamily CalX-like 0.00000445
Family CalX-beta domain 0.027
Further Details:      
 
Domain Number 10 Region: 82-182
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000604
Family Growth factor receptor domain 0.0057
Further Details:      
 
Weak hits

Sequence:  CAOG_06582T0
Domain Number - Region: 543-673
Classification Level Classification E-value
Superfamily CalX-like 0.00251
Family CalX-beta domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_06582T0
Sequence length 1686
Comment | CAOG_06582 | Capsaspora owczarzaki ATCC 30864 tyrosine-protein kinase transforming protein Fes (1687 aa)
Sequence
MDLRATTQDDNNPVWEQYFTTSQVNNYPGSFSVGLDFFDGDFVSTQTLGSIVRTYTAGSS
ADYIPITVTDPFYGAFWIKFAYRVICQTNYYGPTCDTFCTTSTGNCSTCDPVSGACTACK
SGYTGAPSCSTCAPNYYPSGSGSCVYCIPNDGGYYTCSSTGSKVCTPGYTGASCNTLVTC
PTAPAAPTNTTKSQCSSVSANSTCTYQCNAGFSVSSGSPSITCSTAGAWTPAAPTLRCFD
INECNNLNGGCNQTCLNTPGSYDCSCLTGYTKNGDGKGASGCLDNNECSSANGGCQHTCT
NLPGTYACSCNSGYQLQPDAKSCININECTTGTHNCAANATCADTIGSFTCTCKAGFSGN
GTHCDDVNECNGIPFPCSSDALCTNTPGNYSCACKPGFLGNGLECAADGRVAFDVSSRFL
VVRRPASGTSTISLVVEAPVEVPAASVQFTISSASLTAASSAPLQFSSTVHQQTITLNLA
ASGSALAQETVDIQLANPLNMALDDHFNTAQIVIEASQSQFGTVGVSAGSRQISLSNVMA
NPEFSITLERFSAVSYASAVDVTFSVTSTVASATTFVATIPAGQQTFAVLITVPNMGTPT
VPSTLTYTITAATAVTLGEATPIGYYGSSVVAVPEHDYPYGLFSIANTASSWPEPSSASL
TITRARGSVGTVTVRVTPYAVAFNTTTGTPVATIDSDFASTPVDVEFTAGILTKNALVAI
LDDTIPELAEVFGVRLEIVSGGGAVDSTASDVLVTIAESDSPHGVLAFDAATLAVDEPAS
DSSVSITITRTAGLFGDVTFAWATSITGSDHSVNAQAGLDFVEGAGTVTLLQGHSSAVIQ
VVIRADSLPELDETFAVTLSSPTGGATLGAQSTITVTINKNDKPYGTIGFVTPTLTKSAD
GSARFLVTRGSTFTAEVARYFGTFGTVTGDATLQFTTPVTAADFNNQVVRTVSFAAGQTS
QTSNSFNVVAAQAPVRLFNIVLSPSSGSLATLDADAPSVIPCAIEASNAVDGVVRFTSLT
FIAQESAGVALVTVERTGSALGAVTFTYSVRTGTAGGEDFDASIQDAPVVIEAGAASTVI
SIAVDDDDIPELDETFTVLLTGITAGSAYLTYASVATVTIAANDDPYGRMEFAPSGNPLG
DDVYTVWEGTPSLTIPVLRNAGVLGAVAVTVVAGTNASIAPFTPFLNRYHPEQGVSLTSD
LQVTSPLLVRFAAAQSSTTDLLVLTIRNDDIPEGTKALYLALQNPTNGATLGPLIMVELR
DSDEEEDSAASSAAATVPIAIGAVVGCAAVILLVAIVLRRRKRARHQNQLLKATESGYAV
PMQTVTIPSKGDASEPLYATATATYSNSAASATSGSANYDTIDARRNPTDTIYDDAVPLS
RIHTTPTAISNQLRNNLVLGETLGSGAFGVVVAGQLSLEFVPQDAIYLCAKRNQSTLAVA
VKQLAADATEKSRREFFEEAQMVCRFSHPNIVRALGALLEREPNMCILELMPYGDLRSVL
RSSLKDNAYWSAAEMSFALQQVASGLAYLETQNFVHRDLAARNCLVGAGLSVKISDFGLS
RALEEKDYYHMETNGRLPVKWMAPECLNFRRFTHQSDVWAFGVLAWEVYAYGATPYGNLT
AGREVLAQVEAGLRLQKPESCPDAAYALLERCWDLIPTARPTASELQKFFAMGASEGAIR
DIGAML
Download sequence
Identical sequences CAOG_06582T0 XP_004345331.1.32957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]