SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52142239|ref|YP_084593.1| from Bacillus cereus E33L

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52142239|ref|YP_084593.1|
Domain Number 1 Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0000589
Family Surp module (SWAP domain) 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|52142239|ref|YP_084593.1|
Domain Number - Region: 84-186
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.0228
Family MAPEG domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|52142239|ref|YP_084593.1|
Sequence length 240
Comment hypothetical protein BCZK3006 [Bacillus cereus E33L]
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFVFGVISLLYEWRILLFVIVMIPLFIVNMHYARQKNERALLNDISAIV
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
VLTVIVFAINPLCSLIFIPSVIRAIILYGKKNSIIKVGILEIVNSVYFLIITAIIMKYAI
Download sequence
Identical sequences Q638S4
gi|52142239|ref|YP_084593.1| WP_000779969.1.29451 WP_000779969.1.30336 288681.BCZK3006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]