SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|3886|gm1.2126_g from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|3886|gm1.2126_g
Domain Number 1 Region: 162-258
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000575
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|3886|gm1.2126_g
Sequence length 267
Sequence
MQENSQEGYKPTVCLTVLEIDTITQSESDGDTQHGTSCPNRGPKWKDIQHGYTKHIGLEF
YENKSHKTLKPILSNPLRPDFPDQLIGLTNIVVERSCTSESSRKHKAHDFADAMELFPPN
VPSFDYTCVGGLDLTKPIERECTQVNGVNIKIKKFDSSLSEYFFFRESQTLVAHLENGQV
FMSQNEGLTWSNPFENKLDKVAAIFHHYFTHDELRTTTAMNTPTEPNTMDIPAFASQNNG
ETWKSIGKYVRNCQWARSLALQNIHQM
Download sequence
Identical sequences A0A137PE23
jgi|Conco1|3886|gm1.2126_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]