SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|59494|estExt_Genewise1Plus.C_1230011 from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|59494|estExt_Genewise1Plus.C_1230011
Domain Number 1 Region: 734-883,1041-1203
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.17e-41
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0066
Further Details:      
 
Domain Number 2 Region: 30-203,318-324,368-528
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.44e-32
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0098
Further Details:      
 
Domain Number 3 Region: 1402-1574,1721-1859
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 9.15e-32
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|59494|estExt_Genewise1Plus.C_1230011
Sequence length 2181
Sequence
MMITNIFQYFKVIGIWYILISFAFAGDINIHSSDFDKNPSKFIYFDKTDTLLYLESSTKK
LFISEDEGKSWKKVSEIEEGKADGVYKHPFDSSRAIVTTSENAHYTTEDKGKTWKKFETD
YSPSWDSSVFSFHAQRPGFVIYIASDCSNSDGTCVDKAYYTEDFFKTNPKLLLSNISTCV
WGRSTAQLTSVPNQSIFCIWGGDSKNKDAASIIKDSKLVHSENFFQNDKTLIDFDFDGVP
DGGVIGVTISEKFIIAAVKRDVSSEELTLFVSQEGKVWAEAHIPDHKSLKHNAFTVLEST
PSSLALDVVFNSSDKFGTLYLSNSNGTYFTTSLSHTNRDSSGIVDAERIPGTLGTTVANV
VSNWEEIQRTNPNLDKKLHTQITYNNGAKWNYLPSPEKDCNGKSYACKDSKNKEKECSLH
LHSITVPHNLGRMFSASSTPGILIGVGSVGSHLEPYDEGDTFISRDNGGTWNCAREGPHK
YSLLDMGNTIALVKDTKKTDKLVYSSDFGNSWKEKDLGVNVRPLFLTTQSDSTSQIALLL
GQKDDKKHVLIQLDFSKLFDRKCDINKDKPQDSKDLELWKPKYSSSDSKSCVMGSETEYY
RRKKDADCYIGDKFGTPITKSTECPCTEEDYECDYEFIENKDGKCVLKGKELIPKGSCLN
GEKKYFGSSGYRLIPGNTCNMDNKGSKIMDEPVEKDCSEGIQQGNGTTHQIYNVRTQMQY
NILSHFYFNSSEALLILTHKGEVFSSLDGGLSWDIKFTKDVLSIHSHPYAEERAYILLKG
TGMMVTNNRGSTFEEVKLPELPNNLKLNQLEFNSVYKDHIIFIGSNACPNCVAKAYLSTD
NGKNWKQMIDYAHQCAFGKESFSGKSGTVFCSRFIPKDSKADQSALENNRQSPDVKLELV
TIKDGRTNKLLDNIGDFNIVSDYLLVYQKSDQANLLVSKDGVEFTKTIFPPDLVLNHDSF
TILDSYIGGDRIPLTLLKVPVIGQDKPTFGDSSYPIGSLFISNFNATSYSLSLPNIRSNS
KGLVDAESVYGLTGALIANQMIAITADGEAKSKSSISFDNGGSWYPIAPPKKDINGKEYE
CLKDKCSLHLHTFFDKKQTMGSFGTPNSQGYVIGVGNVGQHLLSYEDSSTFFSKDGGVSW
KEIRSAESLYAIGDSGSILILVDDEGPTKDIVYSIDGGSTWNTHNFIRDPVRVASLITAP
TGQSLKFTIIGFGVQGKSSKNAGSFKNELITIDFSKVLSSECKMDSSSSKSDFEEWTPSR
PTLKYEKDGNPTVGETTCLLGEKSIYHRKKPDRLCYLGNSTQLLHKESKTCECTELDYEC
DVGYWRSDMNHGDCVLFGKDPLRPTDCKIGNKYKSNSGYRKISSSTCKGGIDLTKSVERE
CTQINGVNTKIKKFDSALSEYFFFRESQTLVAHLENGKVFMSQNEGFTWSNPFEGKIDKV
AAVFHHSFIDDSAYFLTTSKTHYFTHDELRTSTAMNTPTEPNTMDIPAFAFHPEESSWLI
FHGMQNCESKSSNDCHVEAFASQNNGETWKSIGKYVRNCQWARTKKFNHPSKQAIYCEKY
KQQTGNQRNFAGVNLNLLESDSLFDSSSLLFENISGLSIFHEYLVVATPGEKYGTIELQT
STDGKNFSPAKYPPNVGIAHQGFTVLESNTHSLFLHITTNANIKEESGIILTSNSNGTHF
ITSLDNVNRDSQGLVDFEKMAGIEGIAIANQISNPDELKLTKNKKIISKITFNNGANWRL
LSIPSRDIDGNYYSCKGDNCGLHLHSFTRLSDPENIFSSTSSVGIMIGVGNVGEKLLDYN
SADTFLTRDAGLTWSQIRKGPHRFEFGDQGAVMLLVDDTKAVDSIIYTFDQGLTFQSIKL
DPQSKTKYRITEVTTEPQSTSQKFVLFGYSESNSSELIAFHLDFSGLHDRQCISDINYSN
TDFEKWTPSSKTGNSCLFGKQVEYYRRIRDRKCYIGKKFQDPPKTIVKCTCTMEDFECDY
NFERNSEGKCELIQGTLPLKTTCDKNEQVYTISSGYIKLPISECEGGYDYSRRQEVWCPG
KGGLSGWAIFFIVLFSLLALGFFSYVIVKQNRVPLKWSSVSRTLTPYLCFIPMVVMSLMP
SRGPGGFIQKLKNKIRGSQGYVPVAQYDYEDEENSSVLGLQLEDYNVGYVDEDPFETVSD
EDDELREFEIADNPDDENSLI
Download sequence
Identical sequences A0A137P2M6
jgi|Conco1|59494|estExt_Genewise1Plus.C_1230011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]