SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|127608|CE39523_24421 from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|127608|CE39523_24421
Domain Number 1 Region: 49-74,123-197
Classification Level Classification E-value
Superfamily PH domain-like 8.87e-16
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Conco1|127608|CE39523_24421
Domain Number - Region: 21-106
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0968
Family GSPII protein E N-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|127608|CE39523_24421
Sequence length 222
Sequence
MSSAEAPVAAQTEPTAVAQEETVAQQTEETPVSTEEAPAAPVESTIAIIEQGHLFKRGPA
PLRLWQKRLFVLPAEGRPSYTLNNLRQVYRKNVKKSGAPKEEFVKANQYLLHTLATATVN
ASYILAYYKNDSSKDIPNGFINLGLATSVAAAPKIRPNAFVIKTKARDYVLSASTASETE
SWIKTLNEFVNADLPDYSDSEAYKQSYNDLGNFSYGKSLYLY
Download sequence
Identical sequences A0A137PIL4
jgi|Conco1|127608|CE39523_24421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]