SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|14267|gm1.12507_g from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|14267|gm1.12507_g
Domain Number 1 Region: 54-152
Classification Level Classification E-value
Superfamily Rubredoxin-like 4e-29
Family Cytochrome c oxidase Subunit F 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|14267|gm1.12507_g
Sequence length 172
Sequence
MLSKLTIQTVSNISRQFVRSARLTPVATRAFSVATPVRGGDHGHVDVYIGSGAQSGKVPT
DIEQAVGLERVELLAEMEGREFWDMAPLEMTHFGTKKNPIVIESQDQVRYVGCTGYPADS
HDTIWLNVDAAHDVDRCPECGCCYKLKLVDQPEIPEGALFEDAAGQAKLTPQ
Download sequence
Identical sequences A0A137NPA7
jgi|Conco1|14267|gm1.12507_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]