SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|17574|estExt_Genemark1.C_830003 from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|17574|estExt_Genemark1.C_830003
Domain Number 1 Region: 632-821
Classification Level Classification E-value
Superfamily Sec7 domain 5.63e-72
Family Sec7 domain 0.00000417
Further Details:      
 
Domain Number 2 Region: 1141-1499
Classification Level Classification E-value
Superfamily ARM repeat 0.00000724
Family PBS lyase HEAT-like repeat 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|17574|estExt_Genemark1.C_830003
Sequence length 1873
Sequence
MNFEITNQTIEKLQSEAKAKKENELVTLCSKALEDLTQVKSRLVGGKALPPPPSAMEEND
GRDDIIVTDTVSEEFIGDRYYKVFQLGISTKMPIKIQQVTLDALHKLIAHNLLNGNESWE
YNDSLFSNTILSTRSTMVFDNGLINFDQYFKATEVNDLLELHRVWPWNSDVPSTSSPVPK
TKKGYKLIDDLVYSVCRCYNGPKTDESIQIQVAQVLITLYASPCTSIHTVSLLHIIMTLL
NMAIYSTKPSTLNVAKATMIQIVNLAVSRLEECHLRQSSKQSTSSVDVNHSNDEKTPQNE
EVSEAKTSNSLSDEEFTKLEILKLDVLILLQFLCHFSMGNDKLSSDSQVSTALDARCRSY
SLELILSTLNNSGSCFKSDERFQTILKRNLCISLSKNGIFAEATIFELSLSIFIVLFSEF
RALLKNEIELLFKEIYIRLLTMSNSTYYQKSLILQAFMKICDNSQAIVDMYVNYDCHLGS
SSVFEAMVSTLSKISQGRPTKAMQNTQNKGIFNKGDKTEELDKVEENWLRLRGLRCLVTL
IQSLVGWSQMSQSSELPITPVAQSHSRASSEVIDGASDQLKDQRGPIVVNKHHLQHVSIS
DSSPRQLFSPHLLNRPSSTQSEDDPQQLLELSNKKQIWVQGVEKFNQNPKKGIKFLREQG
FVGETSEEVASFLLSKDELSKPSIGEFLGDPDQFNINVMHEFVNQIDFEGLEFVNALRKF
LQLFRLPGESQKIDRIMEKFADRYCETNPNVFNNADAAYVLAFSVIMLNTDQHSNQVRNK
MDKVMFIRNNQGIDNGKNLPQEFLEAIFDDIGENEIIMESERFDDNSSKGDSKAAYQKEA
SYLQKKLLSLFQGIPLRESDQIFLSATQSDHVKPMFGVAWYSIIAALSRIFEEVNEEDNN
EWSGMKDKNPIPEPIRLCLEGFSGAIRITSIYSMDVERNAFVSAMVKFTSLSDIPSIQVK
HVACIHSLLTLAHAYGEYLEDSWDLILDVVSRLDQLKLLSDPAVVKSRKASISSISQQSN
ISNESTEQVSIEGQTMSLPAKDIRLSLNLNTDLTHLQQLKVVPDIGPQLKSLSHQNTLVV
IDQIFSKSVQFGASSILSFYRALCNVSLKEMEELPPANPRSFSLQKIVEITYYNMDRMRL
EWSQIWKVLRPYFNTVGCHRNFNLASIAVDSLRQLGMKFLERKELNHFHTQQEFMKPFEH
IVKYSSSSGIHDLVLQSLTQMVQSKADCLKSGWKSLFTVLNYITKRQPSISVLSSSWKLC
RYVLTTYIEHIDTSFVDGINCLVAFVINPVSQDIRVEALQLFKQISDIQLDGFNQELNSD
GSEFFNEDKLFLKWFPILSGLSKIVIDCPHPQLKSKALNQLFDTVKQCADKFSKEFWKAL
LRSIVAPIFDDLRSTPSLSDSSSATTTTWSEAIENLVSLFRDHYDSLHSNLDYTDYMFDT
LASMLLLHRNEKLTKQSLTLFQILVLENGYRFNEDMWRTVTRCLSSFFDQTTPESLFQLV
PAVSPKTVDLNSHPIAQLTANELNEQSDISSTAQASEIDLNNAPFSSNSESTHAMLDEDN
EIQSPSAPKTTNNIDVPNELFKCSVHLTLLQSLKTILVTPRPESDSSESQQLPLVMLMPR
HISQIWLGLLQKSALFAQKFNEFDELRTHLWRSGYVTHLPHLIRQETSAKGTFIQLGFQV
YGQFGDDYTSSSMGSNDKDDDNVLPTSFFIELNEECYSILNKFEGMLRELPTNPSRSRDL
SNWSHLVSLILTEISNIPWQSSDDLKVEQLRRCLPQYHTLAVNLINTDIVDVRLGVQKFL
RRFGDKILNVLLQGSMTAKELGLKSVSKPSTPVANGGRKFDLNDPSSLISQPPLDIDIPE
SDIPSDINSISLN
Download sequence
Identical sequences A0A137P6E9
jgi|Conco1|17574|estExt_Genemark1.C_830003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]