SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|37792|e_gw1.49.2.1 from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|37792|e_gw1.49.2.1
Domain Number 1 Region: 48-260
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.97e-36
Family Phospholipase D 0.027
Further Details:      
 
Domain Number 2 Region: 292-483
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 5.61e-20
Family Nuclease 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|37792|e_gw1.49.2.1
Sequence length 603
Sequence
MAVLNELIHFECIKCAEEIESWPSDDEHLTVQRSLASPDQISPRVAYKAPFESFAQFRKG
NKCEPLVDGKEFFEKVYEFVKSAKQSIFISAWWLAPFIYLKRDKFPYEKKDRLDHLLWSK
ANEGVKIYILLWSNSIFLGLCSDQAADWFEKLNHDNIFMLRHPLYTLPNFFWSHHQKFLV
VDYKNAIVGGLDLAVGRYDTHEHPQNARPDNYQAFKKDVIERNYISRMPWHDISVAIQGE
AAYDVCINFVERWNHHREQFGSDHLPTIELPELNSIFEEIQEDEENTCQCLLVRSLSEWS
GLQNRTKEASVYGSYISAINNAQHYIYIENQYVVSSTAGGGVENQIIQAVANRVIWAIEN
KRTFRVFIFFPIPEEQGKPANHMLQLSYQTLFRGGFSLMDQIKYTHPEVDPFDYVGFYFL
RNHGKFKEDLEMVAVTDMVFIHSKLLIVDDNVAIIASNNLNDRSMLGDRDSELGAVIIDK
AKVDIQMDGSPFQARKFAFELRMKLWREHLGLVGEKFDNHEWVQKLRDPISSESYNDIFR
KVAEDNTQIYNKAFPQIPSDKHTKLEEWENFCNKVEEGTIKTDVPEDFLDKVQGNLCYHL
LNS
Download sequence
Identical sequences A0A137PA46
jgi|Conco1|37792|e_gw1.49.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]