SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|38883|e_gw1.72.23.1 from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|38883|e_gw1.72.23.1
Domain Number 1 Region: 16-56
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000942
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|38883|e_gw1.72.23.1
Sequence length 106
Sequence
DLLSNEKKIEISSPYNPVHLTHVGFNSDTGEFTGLPKEWQKLLSEAGISENEQQAHPQTV
IDIMGFYTDSNKDQENAVWNKFNNTAKSSKPPMQPPAFENPVSIHL
Download sequence
Identical sequences A0A137P7F5
jgi|Conco1|38883|e_gw1.72.23.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]