SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|6446|gm1.4686_g from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|6446|gm1.4686_g
Domain Number 1 Region: 198-313
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-18
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|6446|gm1.4686_g
Sequence length 319
Sequence
MSATISTAHLNNKRHSPQSLFTTRWDLPVNNNETPSPNYNDSLISLKANLDRLSFQRTLT
SNPNRQSRESGLGSSVGGREEEFPTQFNSDIRGLLDQLDTCWNKVQQQNLRIPTTIDRPH
PANDVAASNISIRERTSIESNINYGHSKSSTITNPFKKLGHRRHRIINPPTASPHSSSSS
VISLDPNTSYPTNPPASSSGQTLGELKESSSISGWLVKLYVINPSLLARKQWKRRYFCLH
DNVLYRFKSSCSSSLPTDKMTIDPESIICVSDGFSGKKRVFQVKTGEECWFLQAETTVQL
KSWLQGLKSIHANPINTHN
Download sequence
Identical sequences A0A137P7K5
jgi|Conco1|6446|gm1.4686_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]