SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|545629002|ref|YP_008579576.1| from Leifsonia xyli subsp. cynodontis DSM 46306

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|545629002|ref|YP_008579576.1|
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-43
Family Ribonuclease PH domain 1-like 0.000000517
Further Details:      
 
Domain Number 2 Region: 339-510
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-43
Family Ribonuclease PH domain 1-like 0.000000606
Further Details:      
 
Domain Number 3 Region: 153-272
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.11e-22
Family Ribonuclease PH domain 2-like 0.0000191
Further Details:      
 
Domain Number 4 Region: 492-591
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.57e-22
Family Ribonuclease PH domain 2-like 0.000021
Further Details:      
 
Domain Number 5 Region: 596-706
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.76e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 277-363
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.85e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|545629002|ref|YP_008579576.1|
Sequence length 764
Comment polynucleotide phosphorylase [Leifsonia xyli subsp. cynodontis DSM 46306]
Sequence
MEGPEITFAEAVLDNGRFGTRTVRFETGRLAQQAQGAVAAYLDEETMLLSATSASKHPKD
NFDFFPLTVDVEERSYAAGKIPGSFFRREGRPSTEAILVCRLIDRPLRPSFVDGLRNEVQ
IVITVLSIAPDEFYDALAINAASASTQISGLPFSGPVAGVRLALIPGNGQHEDQWIAFPK
ASQLEEAVFDLVVAGRVLTNEDGTEGDVAIMMVEAEATEGSWNLIQGGAVKPNEEVVAQG
LEAAKPFIRQLVGAQAALAKQSAKAIADYPVFLHYSQEAYDSVAALAYDELVNVYQIADK
VERQNADDALKERVKAALAEKVEAGALDAEALTQFSAAYKSVSKVVMRGRVLREGVRIDG
RGLTDIRPLDAEVQVIPRVHGSAIFQRGETQILGVTTLNMLKMEQQIDSLSPVTKKRYLH
HYNFPPYSTGETGRVGSPKRREIGHGFLAERALVPVLPSREEFPYAIRQVSEALSSNGST
SMGSVCASTLSLLNAGVPLRAPVAGIAMGLISDVVDGETRYAALTDILGAEDALGDMDFK
VAGTSEFVTAIQLDTKLDGIPSSVLASALKQAKDARTTILSVLDAAIDAPDEMAPTAPRV
ISVQIPVDKIGELIGPKGKTINAIQDETGADISIEEDGTVYIGAVDGPSAEAARAQVNAI
ANPTNPEVGEQFLGTVVKNAAFGAFVSLLPGKDGLLHISEVRKLAGGKRVESVDDVLSIG
QKILVEITKIDDRGKLSLAPVLADEAETHGRDAASEGPEAPAEG
Download sequence
Identical sequences U3PBX4
gi|545629002|ref|YP_008579576.1| WP_021754439.1.53511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]