SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|337286609|ref|YP_004626082.1| from Thermodesulfatator indicus DSM 15286

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337286609|ref|YP_004626082.1|
Domain Number 1 Region: 35-124
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000000000000545
Family Cytochrome c3-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|337286609|ref|YP_004626082.1|
Sequence length 126
Comment Cytochrome c, class III, conserved region [Thermodesulfatator indicus DSM 15286]
Sequence
MKKVWVGILGLIVGLAFYGYAISGDNGPEVITFEGGKKGTVTFHHLKHQKDYGIKCGECH
HGKDHSPYKEGMKIQKCSECHNKDMANKKLNSVKKAMHKNCKGCHKQVKDKHPNAPTKCK
ECHIKK
Download sequence
Identical sequences F8A8M9
gi|337286609|ref|YP_004626082.1| WP_013907860.1.56968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]