SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384536069|ref|YP_005720154.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384536069|ref|YP_005720154.1|
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.5e-36
Family Thioltransferase 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384536069|ref|YP_005720154.1|
Sequence length 111
Comment hypothetical protein SM11_chr1618 [Sinorhizobium meliloti SM11]
Sequence
MSGINDFIDNEVKSNDVVLFMKGTPQFPQCGFSGQVVQILDYVGVDYKGINVLADADLRQ
GIKDYSNWPTIPQLYVKGEFVGGCDIVREMFQAGELQSLLQGQGISVKGAA
Download sequence
Identical sequences A0A0E0UCT0 A0A222I116 F7X814 H0G3F5 Q92PH5
gi|15965534|ref|NP_385887.1| gi|384536069|ref|YP_005720154.1| gi|433613564|ref|YP_007190362.1| gi|384529601|ref|YP_005713689.1| 266834.SMc00538 gi|334316417|ref|YP_004549036.1| NP_385887.1.96377 WP_003531377.1.11889 WP_003531377.1.18618 WP_003531377.1.21755 WP_003531377.1.22199 WP_003531377.1.24285 WP_003531377.1.30341 WP_003531377.1.3038 WP_003531377.1.3110 WP_003531377.1.32135 WP_003531377.1.34728 WP_003531377.1.36091 WP_003531377.1.36292 WP_003531377.1.36834 WP_003531377.1.4234 WP_003531377.1.44594 WP_003531377.1.47143 WP_003531377.1.48083 WP_003531377.1.49828 WP_003531377.1.50755 WP_003531377.1.55094 WP_003531377.1.58221 WP_003531377.1.58608 WP_003531377.1.63001 WP_003531377.1.65778 WP_003531377.1.66997 WP_003531377.1.72343 WP_003531377.1.73540 WP_003531377.1.78492 WP_003531377.1.787 WP_003531377.1.79107 WP_003531377.1.80755 WP_003531377.1.83096 WP_003531377.1.83536 WP_003531377.1.86220 WP_003531377.1.89614 WP_003531377.1.90561 WP_003531377.1.90968 WP_003531377.1.92524 WP_003531377.1.94084 WP_003531377.1.96031 WP_003531377.1.99158 gi|407720723|ref|YP_006840385.1| gi|470188740|ref|YP_007575051.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]