SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384536107|ref|YP_005720192.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384536107|ref|YP_005720192.1|
Domain Number 1 Region: 6-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.96e-48
Family Glutathione peroxidase-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384536107|ref|YP_005720192.1|
Sequence length 155
Comment putative bacterioferritin comigratory protein [Sinorhizobium meliloti SM11]
Sequence
MAGLGQGDVAPEFELPRDGGGSISLAALRGKPIVLFFYPKDDTKACTEEAISFSALAKEF
QEAGIALVGISPDSAKSHDRFTQKHGLTVALGADEDKAAANAYGVWVEKSMYGRKYMGVE
RTTFLIDRQGVISRVWEKVKVPGHADEVLAAAKTL
Download sequence
Identical sequences A0A0E0UCP4 A0A220MXG2 F7X852 Q92PK4
gi|384529561|ref|YP_005713649.1| gi|15965494|ref|NP_385847.1| NP_385847.1.96377 WP_010969433.1.21755 WP_010969433.1.22199 WP_010969433.1.24285 WP_010969433.1.30341 WP_010969433.1.3110 WP_010969433.1.36292 WP_010969433.1.36834 WP_010969433.1.4234 WP_010969433.1.44594 WP_010969433.1.47143 WP_010969433.1.48083 WP_010969433.1.49828 WP_010969433.1.50755 WP_010969433.1.55094 WP_010969433.1.58221 WP_010969433.1.58608 WP_010969433.1.63001 WP_010969433.1.65778 WP_010969433.1.72343 WP_010969433.1.73540 WP_010969433.1.787 WP_010969433.1.79107 WP_010969433.1.80755 WP_010969433.1.83536 WP_010969433.1.86220 WP_010969433.1.89614 WP_010969433.1.90561 WP_010969433.1.90968 WP_010969433.1.92524 WP_010969433.1.94084 WP_010969433.1.99158 gi|470188700|ref|YP_007575011.1| gi|334316377|ref|YP_004548996.1| gi|433613525|ref|YP_007190323.1| gi|384536107|ref|YP_005720192.1| 266834.SMc00524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]