SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384537050|ref|YP_005721135.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384537050|ref|YP_005721135.1|
Domain Number 1 Region: 2-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.1e-42
Family Glutathione peroxidase-like 0.00000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384537050|ref|YP_005721135.1|
Sequence length 179
Comment peroxiredoxin [Sinorhizobium meliloti SM11]
Sequence
MLGRKVPAVTFRTRVRDESVGGSNPFRWQDVTSDDYFAGKRVVLFSLPGAFTPTCSTYQL
PDFEKLTSEFRTLGIDEIYCVSVNDAFVMNAWGKSQGLENVKLIPDGSGEFTRKMGMLVA
KDNLGFGMRSWRYAAVINNGVVEQWFEEEGYSDNCDSDPYGVSSPQNILAALKSKKLAA
Download sequence
Identical sequences A0A0E0UG10 A0A222HPR8 F7X5P2
gi|384530350|ref|YP_005714438.1| gi|334317226|ref|YP_004549845.1| gi|407721525|ref|YP_006841187.1| gi|433614289|ref|YP_007191087.1| WP_013844776.1.21755 WP_013844776.1.22199 WP_013844776.1.3038 WP_013844776.1.3110 WP_013844776.1.36292 WP_013844776.1.36834 WP_013844776.1.4234 WP_013844776.1.47143 WP_013844776.1.48083 WP_013844776.1.49828 WP_013844776.1.50755 WP_013844776.1.55094 WP_013844776.1.63001 WP_013844776.1.65778 WP_013844776.1.73540 WP_013844776.1.787 WP_013844776.1.79107 WP_013844776.1.80755 WP_013844776.1.83536 WP_013844776.1.86220 WP_013844776.1.90968 WP_013844776.1.94084 WP_013844776.1.96031 WP_013844776.1.99158 gi|384537050|ref|YP_005721135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]