SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384537201|ref|YP_005721286.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384537201|ref|YP_005721286.1|
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.68e-27
Family Thioltransferase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384537201|ref|YP_005721286.1|
Sequence length 85
Comment glutaredoxin [Sinorhizobium meliloti SM11]
Sequence
MASVVIYTRQFCGYCTRAKKLLESKGVDFTEYDATYAPELRQEMIEKSRGGRTFPQIIIN
DVPVGGCDDLHALDRAGKLDDLLAA
Download sequence
Identical sequences A0A222H7D6 F7X6Z0 H0G6E8
gi|384537201|ref|YP_005721286.1| WP_003533511.1.21755 WP_003533511.1.22199 WP_003533511.1.3038 WP_003533511.1.3110 WP_003533511.1.32135 WP_003533511.1.36292 WP_003533511.1.36834 WP_003533511.1.4234 WP_003533511.1.47143 WP_003533511.1.48083 WP_003533511.1.49828 WP_003533511.1.50755 WP_003533511.1.55094 WP_003533511.1.63001 WP_003533511.1.66997 WP_003533511.1.73540 WP_003533511.1.787 WP_003533511.1.79107 WP_003533511.1.80755 WP_003533511.1.83536 WP_003533511.1.86220 WP_003533511.1.90968 WP_003533511.1.94084 WP_003533511.1.96031 WP_003533511.1.99158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]