SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384539665|ref|YP_005723749.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384539665|ref|YP_005723749.1|
Domain Number 1 Region: 6-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.09e-40
Family Glutathione peroxidase-like 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384539665|ref|YP_005723749.1|
Sequence length 188
Comment hypothetical protein SM11_pD1416 [Sinorhizobium meliloti SM11]
Sequence
MAATPPLCDFGWPAFDARLPGVDGFTHSIFSQAGPKGLVVAFICNHCPYVKAVIARIVRD
AIDLRAHGIGFVAVNSNDAGNYPQDSFENMKRFASQNALPFPYLHDEGQSVAKAYRAVCT
PDFFGFNKDMKLQYRGRLDASRKEIGPADLRRDLYEAMVMVALFGKGPAEQQPSIGCTIK
WKISAFQV
Download sequence
Identical sequences A0A222GW50 F7XIL5
gi|384539665|ref|YP_005723749.1|NC_017326 gi|384539665|ref|YP_005723749.1| WP_014530810.1.18618 WP_014530810.1.21755 WP_014530810.1.22199 WP_014530810.1.3110 WP_014530810.1.47143 WP_014530810.1.48083 WP_014530810.1.58608 WP_014530810.1.63001 WP_014530810.1.65778 WP_014530810.1.80755 WP_014530810.1.86220 WP_014530810.1.89614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]