SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384539993|ref|YP_005724076.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384539993|ref|YP_005724076.1|
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.31e-37
Family Thioltransferase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384539993|ref|YP_005724076.1|
Sequence length 107
Comment probabable thioredoxin protein [Sinorhizobium meliloti SM11]
Sequence
MPTLKVDTSNFQKEVLNSAEPVVVDFWAPWCGPCKMIAPSLEEISTELAGKVKLVKLNID
ENPELTAEYGVRSIPMLAMFKAGEVADTRVGAAPKTALISWILNAIG
Download sequence
Identical sequences F7XBP5
gi|384539993|ref|YP_005724076.1| gi|384539993|ref|YP_005724076.1|NC_017327 WP_014531028.1.21755 WP_014531028.1.30341 WP_014531028.1.48083 WP_014531028.1.49828 WP_014531028.1.50755 WP_014531028.1.79107 WP_014531028.1.80755 WP_014531028.1.89614 WP_014531028.1.90561 WP_014531028.1.99158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]