SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|384540618|ref|YP_005724701.1| from Sinorhizobium meliloti SM11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384540618|ref|YP_005724701.1|
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-52
Family NQO2-like 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384540618|ref|YP_005724701.1|
Sequence length 168
Comment NuoE2 NADH:quinone oxidoreductase (chain E) [Sinorhizobium meliloti SM11]
Sequence
MTMREEIEAAAARYPDRRSAIMPALMIAQKEHGHLPGPVLEEVAQILGVERVWVYELATF
YTLFHTEPIGRFHLQLCDNVSCMLCGSEALLTHLETTLGIRKGETTPDGAFTLSTVECLG
ACEMAPVMQVGDDYHGNLDAARLDALLESFRAAERVTSVERAAAAPGE
Download sequence
Identical sequences A0A0E0ULG0 A0A222HSD8 F7XEB7 P56910
266834.SMa1526 gi|334319104|ref|YP_004551663.1| gi|384540618|ref|YP_005724701.1| gi|16263283|ref|NP_436076.1| NP_436076.1.96377 WP_010967798.1.21755 WP_010967798.1.24285 WP_010967798.1.30341 WP_010967798.1.34728 WP_010967798.1.36091 WP_010967798.1.36292 WP_010967798.1.36834 WP_010967798.1.4234 WP_010967798.1.44594 WP_010967798.1.48083 WP_010967798.1.49828 WP_010967798.1.50755 WP_010967798.1.55094 WP_010967798.1.58221 WP_010967798.1.58608 WP_010967798.1.65778 WP_010967798.1.787 WP_010967798.1.79107 WP_010967798.1.80755 WP_010967798.1.86220 WP_010967798.1.90968 WP_010967798.1.94084 WP_010967798.1.99158 gi|384532623|ref|YP_005718227.1| gi|16263283|ref|NP_436076.1|NC_003037 gi|384532623|ref|YP_005718227.1|NC_017324 gi|384540618|ref|YP_005724701.1|NC_017327 gi|470184818|ref|YP_007572791.1|NC_020527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]