SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777473|ref|YP_005686638.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385777473|ref|YP_005686638.1|
Domain Number 1 Region: 222-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.7e-40
Family Clostridium neurotoxins, the second last domain 0.077
Further Details:      
 
Domain Number 2 Region: 51-214
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.3e-38
Family Cellulose-binding domain family III 0.0001
Further Details:      
 
Weak hits

Sequence:  gi|385777473|ref|YP_005686638.1|
Domain Number - Region: 494-553
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0141
Family Family 6 carbohydrate binding module, CBM6 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385777473|ref|YP_005686638.1|
Sequence length 1059
Comment S-layer protein [Clostridium thermocellum DSM 1313]
Sequence
MKEKIGKVLRQNKSIISVVVITAILFVYNTGMLFTGIWEGALYNVKAEEVPLKLEFFNNV
KDDNVTLISPYFRVINNSSSDEIYLQHVKIRYYFTLDSSESEETMNYEIYYAGKSNIDGT
GAVEDIKPNTIVKIAKMDIPTDMADHYLEIGFDESCGTIGPDKKVEVMVSISKKKYKKFI
QTNDYSYNDSAENYVSWEKVTLYLDDELISGIEPNMYASRETGAWYMFDEAVEGSTNEFK
DYKGNHGNAVLYSANGVVPGLNGNSVSLDGVDDYVALPDGIAGTFYNFTIAFWVRLDTIG
EQPIFDFFDSGSNNKYMRLTAESDGKIKFAMTQSGYYGEKTITSGSALTEGVWKHVAVTL
SGDTGTLYINGENVGENNTLSLRPLTFLGETSKGYIGKSHQTDSSEDPYYNSYLHGMIDD
FRIFDRALSADEIKTLASVATRVNDSDPGIHYSSGWSHSQERDKGDYLNDVHELDSPDGE
NCFEYTFTGTGVNVIAPQCSDNGDAEIYIDGKLMKSVAMSVYSGYNSQAVVYSKLGLSLG
THTIKVVFKNGIGIIDALDIMTGEIVSPSPTPTPSPTPSPTPTPSPTPSPTPTPSPTPSP
TPTPTPTPSSTPTSTPTPEPSPTSTPTPEPEPEPTSTPTPEPEPEPTSTPTPEPEPEPTS
TPTPEPEPSPTPTPEPEPSPSPTPTPELSPSSTPVPTPTPTPTPAPNPAPEPVPISTPVP
EPILIPTPTPTMTPMPTPTPTLEVKSDPYLSDLVVTGAKLKPAFVPDILNYEAVAEEDVR
FVCIVAYARDDGAEITLNGVPVKSGSISHAVELKEGKNELIVKVVAEDGITSRTHRISVL
LEALQLPTPTPDKSGNPFFSSLEDLLKENEVSPDGTKGGIFDDVPRGYWAEEYIQKLYEK
GIISGIDEKTFMPGRPITRAEFTQIIVNSLKIPYREAGLHFNDVTEKDWYYKSVSSAAAF
GIVVGRPDGSFAPNEFITRQDMAVVIAKFLEKKHDGNLEGMGKGLVFADSGNISEYARDS
VAAVVSQGLMVGKPGNMFDPKGLTTRAEAVTVICKLMKY
Download sequence
Identical sequences WP_014522588.1.19387 gi|385777473|ref|YP_005686638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]