SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777788|ref|YP_005686953.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385777788|ref|YP_005686953.1|
Domain Number 1 Region: 42-448
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.43e-75
Family beta-glycanases 0.00000116
Further Details:      
 
Domain Number 2 Region: 497-564
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.79e-18
Family Type I dockerin domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385777788|ref|YP_005686953.1|
Sequence length 566
Comment glycoside hydrolase [Clostridium thermocellum DSM 1313]
Sequence
MKKAKAIFSLVVALMVLAIFCFAQNTGSTATTAAAAVDSNNDDWLHCKGNKIYDMYGNEV
WLTGANWFGFNCSENCFHGAWYDVKTILTSIADRGINLLRIPISTELLYSWMIGKPNPVS
SVTASNNPPYHVVNPDFYDPETDDVKNSMEIFDIIMGYCKELGIKVMIDIHSPDANNSGH
NYELWYGKETSTCGVVTTKMWIDTLVWLADKYKNDDTIIAFDLKNEPHGKRGYTAEVPKL
LAKWDNSTDENNWKYAAETCAKAILEVNPKVLIVIEGVEQYPKTEKGYTYDTPDIWGATG
DASPWYSAWWGGNLRGVKDYPIDLGPLNSQIVYSPHDYGPSVYAQPWFEKDFTMQTLLDD
YWYDTWAYIHDQGIAPILIGEWGGHMDGGKNQKWMTLLRDYIVQNRIHHTFWCINPNSGD
TGGLVGNDWSTWDEAKYALLKPALWQTKDGKFIGLDHKIPLGSKGISLGEYYGTPQASDP
PATPTATPTKPAASSTPSFIYGDINSDGNVNSTDLGILKRIIVKNPPASANMDAADVNAD
GKVNSTDYTVLKRYLLRSIDKLPHTT
Download sequence
Identical sequences gi|385777788|ref|YP_005686953.1| WP_003518809.1.19387 WP_003518809.1.20586 WP_003518809.1.55520 WP_003518809.1.6636 WP_003518809.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]