SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777795|ref|YP_005686960.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385777795|ref|YP_005686960.1|
Domain Number 1 Region: 97-135,241-372
Classification Level Classification E-value
Superfamily SGNH hydrolase 5.5e-19
Family Putative acetylxylan esterase-like 0.047
Further Details:      
 
Domain Number 2 Region: 35-101
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.32e-18
Family Type I dockerin domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385777795|ref|YP_005686960.1|
Sequence length 511
Comment Dockerin type 1 [Clostridium thermocellum DSM 1313]
Sequence
MKASKVGQKVILFLVSFSLFISCITISATAANGGKLGDINSDGSINSTDVTLLKRHLLRE
NILTGTAYSNADTDGDGKITSIDLSYLKRYVLRLISSFPGETSNNLNIPWDWVGIIGTGQ
SLSVGTTPILSTTQPYNNLKLDLGNLRVPPYDANSSELKLVPLTEPIRSLATGFPSAYPR
NLYGETPHSAMANQITAMVKAAGGNDYISVHTVVGESGQGMSVIKKGATDTGNTGRAYAA
SIFEVTAINRLAKAAGKTYGVGGIILTHGETDCGNPNYENELRQLWSDYNKDIKAITGQT
QNIPMFVVQQHSYPSTGTSASTLAQWKAGVDYPGDIICIGPNYQRTYGGDNVHLTSAGYQ
HLGEKYAQVYYEKVILGKDWKPLQPIKATKNGRTIIVDFHVPVPPLVWDNTLPAPNQNTL
TEWRNGKGFEVTANGSRVTINSVEISGNSVIITCASELPAWGVKVGYAFTGGKARPNGTY
RWGLLRDSDPFIGRSGVAQPNFCVSFEMPVN
Download sequence
Identical sequences WP_003514562.1.19387 WP_003514562.1.20586 WP_003514562.1.55520 WP_003514562.1.60145 WP_003514562.1.6636 WP_003514562.1.6965 gi|385777795|ref|YP_005686960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]