SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777860|ref|YP_005687025.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385777860|ref|YP_005687025.1|
Domain Number 1 Region: 180-409
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.21e-28
Family Type II chitinase 0.0023
Further Details:      
 
Domain Number 2 Region: 51-133
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 8.5e-28
Family Copper amine oxidase, domain N 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385777860|ref|YP_005687025.1|
Sequence length 439
Comment copper amine oxidase-like domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MRRFLLCITLAFIIVSCTTLIAFAQENKAISVFIDGLPVVFDVNPIVQGGRTLVPFRAIA
EALGVKVEWDGDTQTVSATDNKTIVKLQIGNKTAYCNDTPVALDVPPVISGGRTLIPLRF
FSEAFSCKVEWDGVNWMVKITSPPKEMAVIGFYALGDSRTSSWSNLFGVPYPETALGNTD
IVGELALGWYSLDKDGNLLTKSRTGWQRPDGWEAVLEAASKYGLVTEMVVHVTDGDGTLT
SLLSNDAAMATAVGNIIKEAVLYQGINLDFEGLGYNEEDEKLLATQGAFNKFVQLLAERT
NEARLNLTLTLHAPNSAYKGYDYKTLSEYADRIIVMAYDYGTKPEPNALVIQAVEQSLKC
VPKEKLVLGISIPNENSESLISKVGIAKRYQLKGIALWRLGLLTDEMWDTLKATVKIKEI
INDNGNSPQPTEIKPSQQG
Download sequence
Identical sequences WP_003518526.1.19387 WP_003518526.1.20586 WP_003518526.1.55520 WP_003518526.1.6636 WP_003518526.1.6965 gi|385777860|ref|YP_005687025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]