SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777877|ref|YP_005687042.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385777877|ref|YP_005687042.1|
Domain Number 1 Region: 56-136
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000177
Family Pre-dockerin domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385777877|ref|YP_005687042.1|
Sequence length 210
Comment hypothetical protein Clo1313_0502 [Clostridium thermocellum DSM 1313]
Sequence
MRKLQRKPEKERSTKKENEEDRYISVDTEVYRPKSFDALAQFDLSIETVSIEEQTYTICG
YLDSDFTYGQNKAAFFKSGFNVAIRGTNLYDITDENGYFEINGVPSGTHTLVITRPYYLD
ETITNIVTGFEDRVEISTVAKPIKMTAGDIVVDGAINQSVFGKIKFLTFAKFFPQGTGGE
FLCKPCYFTHLISCIQPRFPHSVALSEKQQ
Download sequence
Identical sequences gi|385777877|ref|YP_005687042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]