SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777886|ref|YP_005687051.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|385777886|ref|YP_005687051.1|
Domain Number - Region: 59-90
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 0.000432
Family Copper amine oxidase, domain N 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385777886|ref|YP_005687051.1|
Sequence length 248
Comment copper amine oxidase-like domain-containing protein [Clostridium thermocellum DSM 1313]
Sequence
MKRKTFLQIFALMGVFVLCSGVIAFGSSLTTEIKAILSREVTIKYEGEVQNMKDGLGNPV
YPLMYNGTTYLPIRAVSNMLNIPIEWEAATKTVILGTEEKQPKSVLSFKAKSSNFASKVT
DKGSLVIKGNSGEEIKYNDGICYKIWNATYSSSIDKAYKAEIGGKYSKLCFDAYIHAQEE
YIGKKFKLVIYDVDDNSVRTKIEIVAGEIKELEVNIEGVNTIGFAADYDDSWGRGYTGMA
YFFNPTVK
Download sequence
Identical sequences A3DJN4
gi|125975446|ref|YP_001039356.1| WP_003519419.1.16390 WP_003519419.1.19387 WP_003519419.1.20586 WP_003519419.1.31213 WP_003519419.1.55520 WP_003519419.1.6636 WP_003519419.1.6965 gi|385777886|ref|YP_005687051.1| 203119.Cthe_2966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]