SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385777996|ref|YP_005687161.1| from Clostridium thermocellum DSM 1313

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385777996|ref|YP_005687161.1|
Domain Number 1 Region: 34-172
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.42e-33
Family Cellulose-binding domain family III 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385777996|ref|YP_005687161.1|
Sequence length 445
Comment cellulosome anchoring protein cohesin subunit [Clostridium thermocellum DSM 1313]
Sequence
MKRIKRILAVLTIFALLATINAFTFVSLAQTNTIEIIIGNVKARPGDRIEVPVSLKNVPD
KGIVSSDFVIEYDSKLFKVIELKAGDIVENPSESFSYNVVEKDEIIAVLYLEETGLGIEA
IRTDGVFFTIVMEVSKDVKPGISPIKFESFGATADNDMNEMTPKLVEGKVEIIEASAPEA
TPTPGSTAGSGAGGGTGSSGSGQPSATPTATEKPSTTPKTTEQPHEDIPQSGGTGEHAPF
LKGYPGGLFKPENNITRAEAAVIFAKLLGADENSAGKNSSITFKDLKDSHWAAWAIKYVT
EQNLFGGYPDGTFMPDKSITRAEFATVTYKFLEKLGKIEQGTDVKTQLKDIEGHWAQKYI
ETLVAKGYIKGYPDETFRPQASIKRAESVALINRSLERGPLNGAVLEFTDVPVNYWAYKD
IAEGVIYHSYKIDENGQEVMVEKLD
Download sequence
Identical sequences gi|385777996|ref|YP_005687161.1| WP_003519374.1.19387 WP_003519374.1.20586 WP_003519374.1.55520 WP_003519374.1.6636 WP_003519374.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]